KEGG   Rhodococcus jostii: RHA1_ro00525Help
Entry
RHA1_ro00525      CDS       T00382                                 

Definition
Zn-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rha  Rhodococcus jostii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RHA1_ro00525
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHA1_ro00525
  Lipid metabolism
   00071 Fatty acid degradation
    RHA1_ro00525
  Amino acid metabolism
   00350 Tyrosine metabolism
    RHA1_ro00525
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RHA1_ro00525
   00626 Naphthalene degradation
    RHA1_ro00525
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RHA1_ro00525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
604177..605286
Genome map
AA seq 369 aa AA seqDB search
MKSTMRVARLHEINQPMQIEELPTPEPRATDVLVQVKACNVVPNLSNVLATYSEWFPYLP
LPKLPAIFGLDSAGVVAAVGSHVTDVAVGDRVYVNPGISCGGCRACRQGHDQNCDKYTFM
GYFSFGADGQQIFDAYPYGGLGGYLTAPQRNLVKLPDSVSFEEGARFGYLGTGYSALCKA
GAGAGSTVLIDGISGTLGLGTCLSALALGASHIFGTGRNADLLEDVRSIAPDRIHVLPAG
EGDLRSWVREHNNGEGVDIVIDSLGPGAPAESFLDAITTLRRGGVAVDIGGMMERPPLDM
FSLMCSQISVLGSLWFSTAEAQDMADLAGAGVLDLSVFEHHSFPLEKINEALADLPARHG
GFTNFVSVP
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgaccatgcgcgttgcccgcctccacgagatcaatcagccgatgcagatcgag
gaactcccgacccccgaaccgcgggccaccgacgtgctggtgcaggtcaaggcctgcaac
gtcgtaccgaacctgtccaacgtgctcgccacctacagcgaatggttcccctacctgccg
cttccgaagctccccgccatcttcggcctcgactccgccggcgtcgtcgccgccgtcggc
agccacgtcaccgacgtcgccgtcggcgaccgcgtctacgtcaaccccggaatctcctgc
ggcggctgccgcgcctgccggcaggggcacgatcagaactgcgacaagtacaccttcatg
ggctacttctccttcggcgccgacggccagcaaatcttcgacgcctacccctacggcggg
ctcggtgggtatctgactgcgccgcaacgcaatctggtgaagctgcccgactccgtcagc
ttcgaggaaggcgcccgattcggctacctcggtaccggttactcggccctgtgcaaggcc
ggcgccggcgccggctccaccgtgctgatcgatggcatctccggaaccctgggtctgggt
acctgcctgagcgccctcgcgctcggtgcgagccacatcttcggcaccggccgtaacgcc
gatctcctcgaggacgtccgatccatcgcccccgaccgcatccacgtcctgcctgccggc
gagggcgacctgcgcagctgggtgcgcgaacacaacaacggggagggcgtcgacatcgtc
atcgactcactcggccccggcgcaccggcagaatcgttcctcgacgccatcaccaccctg
cgccgcggcggcgtggccgtcgacatcggtggcatgatggaacgcccaccgctggacatg
ttctcgctgatgtgcagccagatcagcgtcctcggcagcctgtggttctccaccgccgag
gcccaggacatggccgacctcgccggcgccggggtcctcgacctgtcggtgttcgagcac
cacagcttcccgctcgagaagatcaacgaagctctcgccgacctcccggcccggcacggc
ggcttcaccaacttcgtcagcgtcccctga

DBGET integrated database retrieval system