KEGG   Rhodococcus jostii RHA1: RHA1_ro00543Help
Entry
RHA1_ro00543      CDS       T00382                                 

Definition
dihydrolipoyllysine-residue succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rha  Rhodococcus jostii RHA1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rha01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rha00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:rha00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
622504..623607
Genome map
AA seq 367 aa AA seqDB search
MTTEQLEGTTVRMPALGESVDEGTITRWLKQPGDHVTAEEPLLEVATDKVDTEIPSPVTG
ILQRHLAEENDVVAIDAELAIITESGGTAAAPAAPPIPAPTADPAQTPPPPEPDTATPPA
TLGTAASLPATGSTTEKLPRIRRTIAKRMVESLQTAAQLTTVLEVDVTAIARLRATHKDA
FLQRTGIKLSFLPFFAQAAVDALAEHRVLNASLNTDVTEVTYYDHCHLGMAVDSAKGLMV
PVIRDAQQLGIEGLAQAIADKADKVRTGTITADDLTGGTFTLTNTGSRGALFDTPIINQP
QTGILGVGAVVERLVPSRQDGELRIDVRSMAYLSISYDHRIVDGADAARFLTTVKARLEN
GFTPNDL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgaacaactcgaaggcaccacggtgcggatgccggccctcggggagagcgtc
gacgaaggcaccatcacccggtggctcaaacaacccggtgaccacgtcaccgcggaggaa
ccactgctcgaggtcgccaccgacaaggtcgacaccgagattccgtcaccggtcaccggg
attctccagcgccacctcgccgaggagaacgacgtcgtcgccatcgacgccgaactggcc
atcatcaccgaatccggcggcacggctgcggctcccgcggcccctcccataccggcaccg
acggcggatcctgcacagaccccgccgcctccggagccggacacggccacacccccggcc
acactaggcaccgctgcgtcgctgccggcgaccggctcgaccaccgaaaaactaccgcgg
atccgccgcacgatagcgaagcggatggtcgaatcgttgcagaccgccgcccagctgacc
acggtgctcgaggtcgacgtcaccgcgatcgcccggctgcgggccacccacaaggacgcc
ttcctgcagcggaccggaatcaagctgtccttcctgccgttcttcgcccaagccgccgtc
gacgcgttggccgagcaccgggtcctcaacgcctcgctgaacaccgacgtcaccgaggtg
acctactacgaccactgccacctcggcatggccgtcgacagcgcaaagggcctgatggtg
ccggtcatccgagacgcccagcagctcggcatcgagggactggcccaggcgatcgcggac
aaagccgacaaggtccgcaccggcacgatcaccgccgacgacctgacgggcggcaccttc
accctcaccaacaccggcagccggggcgcactgttcgacaccccgatcatcaaccaaccg
cagaccgggatcctcggtgtcggtgccgtggtcgagcgcctggtcccgtcccggcaggac
ggtgagctccgcatcgacgtgcggtcgatggcctacctgtccatctcctacgatcaccgc
atcgtcgacggcgccgacgccgcccgctttctgaccaccgtcaaagcccggctcgaaaac
ggtttcaccccaaacgatctctga

DBGET integrated database retrieval system