KEGG   Rhodococcus jostii: RHA1_ro00899Help
Entry
RHA1_ro00899      CDS       T00382                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rha  Rhodococcus jostii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHA1_ro00899 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RHA1_ro00899 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    RHA1_ro00899 (glcB)
Enzymes [BR:rha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RHA1_ro00899 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
955189..957372
Genome map
AA seq 727 aa AA seqDB search
MTERVEVGGLQVAKVLYDFVNEEALPGTGVDADGFWSGAATVIDELAPKNKALLSTRDDL
QARIDGWHRDRAGTAIDPAEYKAFLTEIGYLVPEPAPFEVSTANVDTEITATAGPQLVVP
VLNARFALNASNARWGSLYDALYGTNAIPDDGGAEAGATYNKVRGDRVIAWARTFLDTAA
PLAQGSHADAARYTVDGTALTVQLADGTVTGLAEPGKFVGYLGDPAAPTSVLLRNHGLHA
EIQIDPTSPIGSTDTAGVKDVVLESAVTTIMDFEDSVAAVDADDKVIGYRNWLGLNRGDL
TEEMTKGGTAFTRRLNPDRTYTAPDGSELTLHGRSLLFVRNVGHLMTTPAILHGDGTEIP
EGILDALITSLCAVHGLSTGEATGPLVNSRTGSIYIVKPKQHGPDEVAFTTELFGRVEQV
LGLPANTLKVGIMDEERRTTVNLAACINEARERVVFINTGFLDRTGDEIHTSMEAGPMIR
KAEMKKQTWITAYEDWNVDTGLACGLQGRAQIGKGMWAMTELMAEMLDQKIGHPKAGANT
AWVPSPTGATLHATHYHQVDVVAVQNQLKGTRRATLDEILTIPLAPSTDWSDAEKQEELD
NNCQSILGYVVRWIDAGVGCSKVPDIHDVALMEDRATLRISSQLLANWIRHGVVTADQVV
QSLQRMAPIVDRQNQNDPTYRPLAPDFDTNIAFQAAKELILDGTTQPSGYTEPILHRRRR
EYKAANA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgtgttgaggtcggcggtctgcaggtcgcgaaggtgctctacgacttcgtg
aacgaggaggcgctgcccgggaccggggtggacgccgacgggttctggtcgggtgcggcc
acggtgatcgacgagctggcgccgaagaacaaggccctgctgtccacccgcgacgacctg
caggcccggatcgacggctggcaccgcgaccgggccgggaccgcgatcgacccggccgag
tacaaggcgttcctgaccgagatcgggtacctggtgcccgaaccggcccccttcgaggtg
tccacggcgaacgtggacaccgagatcaccgccaccgccggcccgcagctggtggtcccg
gtcctcaacgcccgcttcgccctgaacgcctccaacgcccggtgggggtcgctgtacgac
gccctgtacggcaccaacgccatccccgacgacggcggcgcggaggcgggcgccacctac
aacaaggtccgcggcgaccgggtcatcgcctgggcccgcaccttcctcgacaccgccgcc
cccctcgcgcaggggtcgcacgccgacgccgcccgctacaccgtcgacggcaccgcgctg
accgtgcagctcgccgacggcaccgtcaccgggctggcggagccgggtaagttcgtcggc
tacctcggcgacccggccgccccgaccagtgtgctgctgcgcaatcacgggttgcacgcg
gaaatccagatcgaccccacctccccgatcgggtccaccgacaccgccggggtcaaggac
gtggtgctcgagtccgcggtcaccaccatcatggacttcgaggactccgtcgccgccgtc
gacgccgacgacaaggtgatcggctaccgcaactggctgggcctcaaccgcggcgacctg
accgaggagatgaccaagggcggcaccgcgttcacccgccgcctcaacccggaccgcacc
tacaccgccccggacgggtccgagctcaccctgcacgggcggtcgctgctgttcgtccgc
aacgtcgggcacctgatgaccaccccggcgatcctgcacggcgacggcaccgaaatcccc
gagggcatcctcgacgccctgatcacctccctgtgcgccgtccacggactcagcacgggc
gaggcgacggggccgttggtcaactcccgcaccgggtcgatctacatcgtcaaacccaag
cagcacggccccgacgaggtcgcgttcaccaccgaactgttcggccgcgtcgagcaggtc
ctcgggctgcccgccaacaccctcaaggtcggcatcatggacgaggaacgccgcaccacc
gtcaacctcgccgcctgcatcaacgaagcccgggagcgggtggtgttcatcaacaccggg
ttcctcgaccgcaccggcgacgagatccacacctcgatggaggccgggccgatgatccgc
aaggccgagatgaagaagcagacctggatcaccgcctacgaggactggaacgtcgacacc
ggactcgcctgcgggctgcaggggcgggcgcagatcggcaagggcatgtgggcgatgacc
gagctgatggccgagatgctcgaccagaagatcggccaccccaaggccggcgcgaacacc
gcatgggtgccgtccccgaccggggccaccctgcacgccacccactaccaccaggtcgac
gtcgtcgccgtccaaaaccagctgaagggcacccggcgggccaccctcgacgagatcctc
accatccccctcgcccccagcaccgactggtccgacgccgagaaacaggaagaactcgac
aacaactgccagtccatcctcggctacgtggtccgctggatcgacgccggcgtcggctgc
tccaaggtccccgacatccacgacgtcgccctgatggaagaccgcgccaccctccgcatc
tcctcccagctgctggcgaactggatccggcacggcgtggtcaccgccgaccaggtcgtg
cagtcactgcaacggatggccccgatcgtggaccggcagaaccagaacgaccccacctac
cggcccctggccccggacttcgacaccaacatcgccttccaggccgcgaaggaactcatc
ctcgacggcaccacccaaccctccggctacaccgaaccgatcctgcaccgccgccgccgc
gaatacaaagcagccaacgcctga

DBGET integrated database retrieval system