KEGG   Rhodococcus jostii RHA1: RHA1_ro00899Help
Entry
RHA1_ro00899      CDS       T00382                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
rha  Rhodococcus jostii RHA1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:rha01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rha00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:rha00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
955189..957372
Genome map
AA seq 727 aa AA seqDB search
MTERVEVGGLQVAKVLYDFVNEEALPGTGVDADGFWSGAATVIDELAPKNKALLSTRDDL
QARIDGWHRDRAGTAIDPAEYKAFLTEIGYLVPEPAPFEVSTANVDTEITATAGPQLVVP
VLNARFALNASNARWGSLYDALYGTNAIPDDGGAEAGATYNKVRGDRVIAWARTFLDTAA
PLAQGSHADAARYTVDGTALTVQLADGTVTGLAEPGKFVGYLGDPAAPTSVLLRNHGLHA
EIQIDPTSPIGSTDTAGVKDVVLESAVTTIMDFEDSVAAVDADDKVIGYRNWLGLNRGDL
TEEMTKGGTAFTRRLNPDRTYTAPDGSELTLHGRSLLFVRNVGHLMTTPAILHGDGTEIP
EGILDALITSLCAVHGLSTGEATGPLVNSRTGSIYIVKPKQHGPDEVAFTTELFGRVEQV
LGLPANTLKVGIMDEERRTTVNLAACINEARERVVFINTGFLDRTGDEIHTSMEAGPMIR
KAEMKKQTWITAYEDWNVDTGLACGLQGRAQIGKGMWAMTELMAEMLDQKIGHPKAGANT
AWVPSPTGATLHATHYHQVDVVAVQNQLKGTRRATLDEILTIPLAPSTDWSDAEKQEELD
NNCQSILGYVVRWIDAGVGCSKVPDIHDVALMEDRATLRISSQLLANWIRHGVVTADQVV
QSLQRMAPIVDRQNQNDPTYRPLAPDFDTNIAFQAAKELILDGTTQPSGYTEPILHRRRR
EYKAANA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgtgttgaggtcggcggtctgcaggtcgcgaaggtgctctacgacttcgtg
aacgaggaggcgctgcccgggaccggggtggacgccgacgggttctggtcgggtgcggcc
acggtgatcgacgagctggcgccgaagaacaaggccctgctgtccacccgcgacgacctg
caggcccggatcgacggctggcaccgcgaccgggccgggaccgcgatcgacccggccgag
tacaaggcgttcctgaccgagatcgggtacctggtgcccgaaccggcccccttcgaggtg
tccacggcgaacgtggacaccgagatcaccgccaccgccggcccgcagctggtggtcccg
gtcctcaacgcccgcttcgccctgaacgcctccaacgcccggtgggggtcgctgtacgac
gccctgtacggcaccaacgccatccccgacgacggcggcgcggaggcgggcgccacctac
aacaaggtccgcggcgaccgggtcatcgcctgggcccgcaccttcctcgacaccgccgcc
cccctcgcgcaggggtcgcacgccgacgccgcccgctacaccgtcgacggcaccgcgctg
accgtgcagctcgccgacggcaccgtcaccgggctggcggagccgggtaagttcgtcggc
tacctcggcgacccggccgccccgaccagtgtgctgctgcgcaatcacgggttgcacgcg
gaaatccagatcgaccccacctccccgatcgggtccaccgacaccgccggggtcaaggac
gtggtgctcgagtccgcggtcaccaccatcatggacttcgaggactccgtcgccgccgtc
gacgccgacgacaaggtgatcggctaccgcaactggctgggcctcaaccgcggcgacctg
accgaggagatgaccaagggcggcaccgcgttcacccgccgcctcaacccggaccgcacc
tacaccgccccggacgggtccgagctcaccctgcacgggcggtcgctgctgttcgtccgc
aacgtcgggcacctgatgaccaccccggcgatcctgcacggcgacggcaccgaaatcccc
gagggcatcctcgacgccctgatcacctccctgtgcgccgtccacggactcagcacgggc
gaggcgacggggccgttggtcaactcccgcaccgggtcgatctacatcgtcaaacccaag
cagcacggccccgacgaggtcgcgttcaccaccgaactgttcggccgcgtcgagcaggtc
ctcgggctgcccgccaacaccctcaaggtcggcatcatggacgaggaacgccgcaccacc
gtcaacctcgccgcctgcatcaacgaagcccgggagcgggtggtgttcatcaacaccggg
ttcctcgaccgcaccggcgacgagatccacacctcgatggaggccgggccgatgatccgc
aaggccgagatgaagaagcagacctggatcaccgcctacgaggactggaacgtcgacacc
ggactcgcctgcgggctgcaggggcgggcgcagatcggcaagggcatgtgggcgatgacc
gagctgatggccgagatgctcgaccagaagatcggccaccccaaggccggcgcgaacacc
gcatgggtgccgtccccgaccggggccaccctgcacgccacccactaccaccaggtcgac
gtcgtcgccgtccaaaaccagctgaagggcacccggcgggccaccctcgacgagatcctc
accatccccctcgcccccagcaccgactggtccgacgccgagaaacaggaagaactcgac
aacaactgccagtccatcctcggctacgtggtccgctggatcgacgccggcgtcggctgc
tccaaggtccccgacatccacgacgtcgccctgatggaagaccgcgccaccctccgcatc
tcctcccagctgctggcgaactggatccggcacggcgtggtcaccgccgaccaggtcgtg
cagtcactgcaacggatggccccgatcgtggaccggcagaaccagaacgaccccacctac
cggcccctggccccggacttcgacaccaacatcgccttccaggccgcgaaggaactcatc
ctcgacggcaccacccaaccctccggctacaccgaaccgatcctgcaccgccgccgccgc
gaatacaaagcagccaacgcctga

DBGET integrated database retrieval system