KEGG   Rhodococcus jostii: RHA1_ro00912Help
Entry
RHA1_ro00912      CDS       T00382                                 

Definition
(GenBank) probable strictosidine synthase
  KO
K01757  
strictosidine synthase [EC:4.3.3.2]
Organism
rha  Rhodococcus jostii
Pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
Enzymes [BR:rha01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.2  strictosidine synthase
     RHA1_ro00912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(969987..971045)
Genome map
AA seq 352 aa AA seqDB search
MTFFESLARKLDRTGVDPTVWHAPPPPPPTGVLAPNGMLDDAHRWTLPAGEGPEDVAVDH
DGRVVTGGNDGRIWRFDGHGHATELANTHGRPLGVEILDDGRFLICDAERGVLRVDDQGR
VDVLADAAAGRPLVACNNSAVGRDGIVYFTDSSAHFTIADHRYDLLEHRGTGRLLRLDPR
TGETDLLAEGLQFANGVGLASDESFVLVAETGSYQISRVDLTGPSQGAASVWAANLPGIP
DNMTSQTRDGLFWVALYSPRMRLLDLLAPYPTLRIVAANLPEAVQPNPEHAGWVIALDHR
GEIVHSLRGGKGSYSPVTGVREHDGWLYLGSLTADAVARVPAPPRPDVARGE
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtgaccttcttcgagtctctcgcccgcaagctcgaccgcaccggtgtcgaccccaccgtc
tggcacgccccgccgccaccaccaccgacgggagtgctcgcgccgaacgggatgctcgac
gacgcgcaccgctggacgctccccgccggagaaggcccggaggacgtcgccgtcgatcac
gacggccgggtggtcaccggaggcaacgacggccggatctggcggttcgacggccacgga
cacgccaccgaactcgcgaacacccacgggcggcctctcggggtcgagatactcgacgac
ggccggttcctgatctgcgacgccgagcgcggtgtgctgcgagtcgacgaccagggacgc
gtcgacgtgctcgccgacgccgcggccgggcgcccgctcgtggcgtgcaacaactcggcg
gtcggcagggacggcatcgtgtacttcaccgactcctcggcgcacttcacgatcgccgac
caccgctacgaccttctcgagcaccgcgggaccggccgcctgctgcgtctggacccgcgg
acgggggagaccgacctcctggccgaggggctgcagttcgccaacggcgtgggactggcc
tcggacgagtcgttcgttctcgtcgccgagaccggctcgtaccagatctcccgcgtcgac
ctgaccggcccgtcgcagggtgcggcgtcggtgtgggccgcgaatctgcccggcataccg
gacaacatgacgtcccagacacgggacggcctgttctgggtggcgctctacagcccgcgg
atgcggttgctcgacctgctcgcgccgtacccgacgctgcggatcgtcgcggcgaacctg
ccggaggccgtgcaaccgaatccggagcacgccggctgggtgatcgccctcgatcaccgc
ggcgagatcgtgcacagcctgcgcggaggcaagggcagctattcccccgtcacaggtgtg
cgggagcacgacgggtggctgtacctgggaagtctgaccgcggacgccgtcgcacgcgta
ccggccccaccacgaccggacgttgcgcggggcgagtga

DBGET integrated database retrieval system