KEGG   Rhodococcus jostii: RHA1_ro01012Help
Entry
RHA1_ro01012      CDS       T00382                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rha  Rhodococcus jostii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RHA1_ro01012 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHA1_ro01012 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RHA1_ro01012 (trpA)
Enzymes [BR:rha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RHA1_ro01012 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1079530..1080333)
Genome map
AA seq 267 aa AA seqDB search
MSERLSRLAPTFAQCREEKRAALVGYLPAGFPTVQESIDVFKAMVESGCDIVEVGIAYSD
PVMDGPTIQAAAETALRNGVRVRDVFTVVEAIASVGGKAVVMTYWNPVLQYGVDKFARDL
ASAGGLGLITPNLIPEEAGEWIAASKEHDLDRIFLVAPSSTEERLSMTLDASSGFVYAAS
TMGVTGARDAVSSMAPELTARIRAHSDIPVGVGLGVRSGAQAAEIAAYADAVIVGSALVT
AAESGLDAVRSLTKELAEGVRSATVAS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaacgactctcgcgcctcgccccgacgttcgcgcagtgccgcgaggagaagcgc
gccgcgctcgtcgggtacctcccggccggtttccccaccgtgcaggagtccatcgacgtg
ttcaaggcgatggtcgaatccggttgcgacatcgtcgaggtcggcatcgcctactccgac
ccggtgatggacgggcccaccatccaggcggcggccgagacggcgctgcggaacggtgtc
cgcgtgcgtgacgtgttcaccgtcgtcgaggcgatcgcctccgtcggcggcaaggccgtc
gtgatgacctactggaatccggtcctgcagtacggcgtcgacaagttcgcgcgcgacctg
gcgagcgcgggcggcctcggcctgatcacacccaacctcatccccgaggaagccggcgag
tggatcgccgcgtcgaaggaacacgacctcgaccggatcttcctcgtggcgccgtcgtcg
accgaggaacgtctctcgatgaccctcgacgcgagcagcggcttcgtgtacgccgcgtcg
acgatgggtgtcaccggtgcccgtgacgcggtgtcgtcgatggcacccgagctgaccgcc
cgtatccgcgcccactcggacattccggtgggtgtcggactgggtgtccgctccggcgcg
caggccgccgagatcgccgcgtacgccgatgcggtcatcgtcggatccgcgctggtcacg
gccgcggagagcggtctcgacgcggtgcgctcgctcacgaaggaactcgccgagggcgtt
cgctccgctaccgtggcgtcgtga

DBGET integrated database retrieval system