KEGG   Rhodococcus jostii: RHA1_ro01013Help
Entry
RHA1_ro01013      CDS       T00382                                 

Gene name
trpB1
Definition
(GenBank) tryptophan synthase beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rha  Rhodococcus jostii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RHA1_ro01013 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHA1_ro01013 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RHA1_ro01013 (trpB1)
Enzymes [BR:rha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RHA1_ro01013 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1080330..1081649)
Genome map
AA seq 439 aa AA seqDB search
MTSRNQETVFKGGNLPTASAGIAERTTHDPDAGGHFGVYGGRHVPEALMAVIEEVTAEYE
KARADDAFLNELDRLQRDYTGRPSPIFEAKRMSEFAGGARLILKREDLNHTGSHKINNVL
GQVLLAKRMGKTRIIAETGAGQHGVATATACALLGLECVIYMGAVDTERQALNVARMRLL
GSSVVSVESGSRTLKDAINEALRDWVTNAHNTYYCFGTAAGPHPFPTIVRDFQRVVGLEA
RAQVQALTGRLPDAVTACVGGGSNAIGIFHAFLDDPAVRLVGYEAAGDGVETGRHAATFA
AGTPGAFQGAYSYLLQDEDGQTIESHSISAGLDYPGVGPEHALLKDIGRATYEPVTDTEA
MDALRLLSEREGIIPAIESAHAVAGSLRLGRELGEGAIIVISLSGRGDKDMDTAAKWFGL
FDPDDSTETTTTDKEGSAK
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcacgtaatcaggaaaccgtcttcaagggtggcaatctgccgactgccagcgcc
gggatcgccgagcgcacgacgcacgaccccgacgccggaggacacttcggcgtgtacggc
ggacggcacgtgcccgaggccctgatggcagtgatcgaggaggtcaccgccgagtacgag
aaggcccgcgccgacgacgcgttcctgaacgaactcgatcgtctccagcgtgactacacc
ggccgtccgtccccgatcttcgaggcgaaacggatgagcgagttcgccggtggggcgcgg
ctcatcctcaagcgcgaagacctcaaccacacgggctcgcacaagatcaacaacgtgctc
ggccaggtgctgctcgccaagcggatgggcaagacccgcatcatcgcggagaccggggcc
ggccagcacggtgtggccaccgcgaccgcctgcgcgctcctcggcctggaatgcgtcatc
tacatgggtgccgtcgacaccgagcggcaggcgctgaacgtcgcccgcatgcgcttgctg
ggctcgtcggtggtgtcggtcgagtcggggtcgaggaccctgaaggacgccatcaacgag
gcgctgcgcgactgggtcaccaacgcccacaacacgtattactgcttcggcaccgctgcc
gggccgcacccgttcccgaccatcgtccgcgacttccagcgcgtcgtcggtctggaggcg
cgtgcccaggtgcaggcgctgaccggtcggctgcccgacgccgtgacggcgtgtgtcggc
ggcggttccaacgccatcggcatcttccacgcgttcctcgacgaccccgccgtgcggctg
gtcggctacgaggccgccggtgacggcgtcgagaccgggcggcacgccgccacgttcgcc
gcgggcaccccgggcgcgttccagggtgcgtactcgtacctgctgcaggacgaagacggc
cagaccatcgagtcgcactcgatctccgcgggcctcgactaccccggtgtcggacccgag
cacgcactcctcaaggacatcggccgcgccacctacgagccggtcaccgacacggaggcc
atggacgcgctccgtctgctgtccgagcgggagggcatcatcccggccatcgagtccgcc
cacgccgtcgccgggtcgctgagactgggccgcgaactgggggagggcgccatcatcgtc
atcagcctgtccgggcgcggcgacaaggacatggacacggccgccaagtggttcggactg
ttcgatcccgacgactcgaccgagaccaccacgactgacaaggaaggttcggccaagtga

DBGET integrated database retrieval system