KEGG   Rhodococcus jostii: RHA1_ro01013Help
Entry
RHA1_ro01013      CDS       T00382                                 

Gene name
trpB1
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rha  Rhodococcus jostii
Pathway
rha00260  Glycine, serine and threonine metabolism
rha00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01130  Biosynthesis of antibiotics
rha01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHA1_ro01013 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RHA1_ro01013 (trpB1)
Enzymes [BR:rha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RHA1_ro01013 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Gmad2
Motif
Other DBs
NCBI-ProteinID: ABG92840
UniProt: Q0SHZ6
Position
complement(1080330..1081649)
Genome map
AA seq 439 aa AA seqDB search
MTSRNQETVFKGGNLPTASAGIAERTTHDPDAGGHFGVYGGRHVPEALMAVIEEVTAEYE
KARADDAFLNELDRLQRDYTGRPSPIFEAKRMSEFAGGARLILKREDLNHTGSHKINNVL
GQVLLAKRMGKTRIIAETGAGQHGVATATACALLGLECVIYMGAVDTERQALNVARMRLL
GSSVVSVESGSRTLKDAINEALRDWVTNAHNTYYCFGTAAGPHPFPTIVRDFQRVVGLEA
RAQVQALTGRLPDAVTACVGGGSNAIGIFHAFLDDPAVRLVGYEAAGDGVETGRHAATFA
AGTPGAFQGAYSYLLQDEDGQTIESHSISAGLDYPGVGPEHALLKDIGRATYEPVTDTEA
MDALRLLSEREGIIPAIESAHAVAGSLRLGRELGEGAIIVISLSGRGDKDMDTAAKWFGL
FDPDDSTETTTTDKEGSAK
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcacgtaatcaggaaaccgtcttcaagggtggcaatctgccgactgccagcgcc
gggatcgccgagcgcacgacgcacgaccccgacgccggaggacacttcggcgtgtacggc
ggacggcacgtgcccgaggccctgatggcagtgatcgaggaggtcaccgccgagtacgag
aaggcccgcgccgacgacgcgttcctgaacgaactcgatcgtctccagcgtgactacacc
ggccgtccgtccccgatcttcgaggcgaaacggatgagcgagttcgccggtggggcgcgg
ctcatcctcaagcgcgaagacctcaaccacacgggctcgcacaagatcaacaacgtgctc
ggccaggtgctgctcgccaagcggatgggcaagacccgcatcatcgcggagaccggggcc
ggccagcacggtgtggccaccgcgaccgcctgcgcgctcctcggcctggaatgcgtcatc
tacatgggtgccgtcgacaccgagcggcaggcgctgaacgtcgcccgcatgcgcttgctg
ggctcgtcggtggtgtcggtcgagtcggggtcgaggaccctgaaggacgccatcaacgag
gcgctgcgcgactgggtcaccaacgcccacaacacgtattactgcttcggcaccgctgcc
gggccgcacccgttcccgaccatcgtccgcgacttccagcgcgtcgtcggtctggaggcg
cgtgcccaggtgcaggcgctgaccggtcggctgcccgacgccgtgacggcgtgtgtcggc
ggcggttccaacgccatcggcatcttccacgcgttcctcgacgaccccgccgtgcggctg
gtcggctacgaggccgccggtgacggcgtcgagaccgggcggcacgccgccacgttcgcc
gcgggcaccccgggcgcgttccagggtgcgtactcgtacctgctgcaggacgaagacggc
cagaccatcgagtcgcactcgatctccgcgggcctcgactaccccggtgtcggacccgag
cacgcactcctcaaggacatcggccgcgccacctacgagccggtcaccgacacggaggcc
atggacgcgctccgtctgctgtccgagcgggagggcatcatcccggccatcgagtccgcc
cacgccgtcgccgggtcgctgagactgggccgcgaactgggggagggcgccatcatcgtc
atcagcctgtccgggcgcggcgacaaggacatggacacggccgccaagtggttcggactg
ttcgatcccgacgactcgaccgagaccaccacgactgacaaggaaggttcggccaagtga

DBGET integrated database retrieval system