KEGG   Rhodococcus jostii: RHA1_ro01014Help
Entry
RHA1_ro01014      CDS       T00382                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rha  Rhodococcus jostii
Pathway
rha00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01130  Biosynthesis of antibiotics
rha01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RHA1_ro01014 (trpC)
Enzymes [BR:rha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RHA1_ro01014 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh OMPdecase
Motif
Other DBs
NCBI-ProteinID: ABG92841
UniProt: Q0SHZ5
Position
complement(1081712..1082521)
Genome map
AA seq 269 aa AA seqDB search
MTVLDSILDGVRADVAAREAVLDFAAVKAAAAAAPPALDAAAALLEPGIGVIAEVKRASP
SKGALADITDPAELAAAYQAGGARVISVLTEERRFQGSLADLDAVRRAVSIPILRKDFIV
GPYQIHEARAHGADVVLLIVAALEQDALASLIDRTESLGMTALVEVHTEEEANRALEAGA
KVIGVNARNLKTLEVDKNTFGEIAPGLPTEIIKIAESGVRGTADLLAYAGAGADAVLVGE
GLVTSGDPRKAVADLVNAGAHPSCPKPSR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttctcgactcgattctcgacggggtgcgcgccgacgtcgccgcccgcgaagcc
gtccttgacttcgccgcagtcaaggctgccgccgctgccgcaccgccggccctcgatgcc
gcggccgccctgctcgagccgggcatcggagtcatcgccgaggtcaagcgcgcgagcccc
tcgaagggcgcgctcgccgacatcaccgatcccgccgagttggccgccgcctaccaggcc
ggtggcgcccgcgtgatcagcgtgctcaccgaggagcgccggttccaggggtccctcgcg
gacctcgacgcggtccgccgcgcggtgagcatcccgatcctccgcaaggacttcatcgtc
gggccgtatcagatccacgaggcccgcgcccacggcgccgacgtcgtgctgctcatcgtc
gccgccctcgaacaggacgcgcttgcgtcgctgatcgaccgcacggagtcgctgggcatg
acggccctcgtcgaggtccacaccgaggaagaggccaaccgggcgctcgaggccggtgcc
aaggtcatcggcgtcaatgcccgcaatctcaagacgctcgaggtcgacaagaacacgttc
ggcgagatcgctcccgggctgccgaccgagatcatcaagatcgccgagtccggtgtgcgc
ggcacagccgacctgctggcctacgccggtgcgggagccgacgcggtgctggtcggcgaa
ggcctcgtcaccagcggggatccgcgcaaggcggtggccgatctggtcaacgcaggcgct
cacccgtcctgccccaagccgtcacgctga

DBGET integrated database retrieval system