KEGG   Rhodococcus jostii: RHA1_ro01138Help
Entry
RHA1_ro01138      CDS       T00382                                 

Gene name
asn1
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rha  Rhodococcus jostii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RHA1_ro01138 (asn1)
Enzymes [BR:rha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     RHA1_ro01138 (asn1)
Peptidases [BR:rha01002]
 Cysteine Peptidases
  Family C44
   RHA1_ro01138 (asn1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1211617..1213542
Genome map
AA seq 641 aa AA seqDB search
MCGLLGLLTSGETSDNAVSQVDQAMHCLRHRGPDEHGTWHDDHLVFGFNRLSIIDIEHSH
QPLRWGPAENPERYALTFNGEIYNYLEVRAELAEQFGAQFVTEGDSESIVAAFHYWGEDA
VRRLRGMFAFAIWDTETRELFIARDPFGIKPLFLATGTGGTAFGSEKKSLLELASLIGIG
TELDPRAVEHYTVLQYVPEPETLHKQIRRLESGCFARVRPGEEPVITRYFAPTFPVRPFA
AGTDQARYREIAEALEDSVAKHMRADVTVGSFLSGGIDSTAIAALAMRHNPNLITFTTGF
EREGYSEVDVAAESAEAIGARHVVKVVSPSEFAAAIPEIVWYLDDPVADPALVPLWFVAK
EARKHVKVVLSGEGADELFGGYTIYREPISLKPFEYLPKGLRRAAGKLSERIPEGTRGKS
LLNRGSLTLEERYYGNARSFNDAQLRAVLRDFRPEWTHRDVTDPIYAQSQGWDPVARMQH
LDLFTWLRGDILVKADKMTMANSLELRVPFLDPEVFKVASQVPLDQKITKSTTKYALRQA
LEGIVPGHVLHRAKLGFPVPLRHWLRGTELFDWAHEQIAASGTDHLLDKAAITKMLNDHR
DGVSDHSRRLWTVLIFMVWHGIFVENRIVPEIAEPAYPVSL
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcggactgctcgggctactgacctctggagaaaccagcgacaacgccgtctcacag
gtcgaccaggcgatgcactgcctgcggcaccgtgggccggacgagcacgggacctggcac
gacgaccatctggtcttcgggttcaatcggctgtcgatcatcgacatcgaacactcccac
cagccgttgcggtggggtccggcggagaatccggaacgctacgcgctcaccttcaacggc
gagatctacaactacctcgaggttcgcgccgaactcgccgagcagttcggtgcgcagttc
gtcacagagggcgacagcgagtccatcgtcgccgcgttccactactggggcgaagacgcc
gtccgtcgtctgcgcggcatgttcgcgtttgcgatctgggacacggagacgcgggagctg
ttcatcgcgcgcgatccgttcgggataaagccgctcttcctggccacgggcaccggcggc
accgcgttcggtagcgagaagaagagcctgctggagctggcgagcctgatcggtatcggc
accgaactcgatccgcgggccgtcgagcactacaccgtcctgcagtacgtgccggagccg
gaaaccctccacaagcagatccgccgcctcgagtccggttgcttcgcccgcgtgcgcccg
ggcgaagaacccgtgatcacccgctatttcgcgcccaccttcccggtgcgtccgttcgcc
gcgggcaccgaccaggcccgataccgcgagatcgccgaggcactcgaggattcggtcgcc
aagcacatgcgcgccgacgtcacggtcgggtccttcctgtcgggtggcatcgactcgacg
gccatcgcggcgctcgcgatgcgccacaacccgaacctgatcacgttcaccaccggtttc
gagcgcgagggctactccgaggtcgacgtcgcagccgaatccgccgaagcgatcggcgcg
cgccacgtggtgaaggtggtgagcccgtccgagttcgccgccgccatccccgagatcgtg
tggtacctcgacgacccggtcgccgatcccgcgctggttccgctgtggttcgtggccaag
gaagcgcgcaagcacgtcaaggtcgtgctgtccggtgagggcgccgacgagctgttcggc
gggtacaccatctaccgcgagccgatttcgctgaagccgttcgagtacctgcccaaggga
ctgcggcgggccgcagggaagctgtccgagcgcatccccgagggcacccggggaaagagc
ctgctcaaccgcggttcactgaccctggaagagcggtactacggcaacgcgcgcagcttc
aacgacgcacagctgcgcgccgtcctgcgcgacttccggccggagtggacgcaccgcgac
gtcaccgacccgatctacgcgcagtcgcaggggtgggatccggtggcccggatgcagcac
ctggacctgttcacgtggttgcgcggcgacatcctcgtcaaggccgacaagatgacgatg
gcgaactcgctcgaactgcgggtgccgttcctcgatcccgaggtcttcaaggtggcgtcg
caggtgccgttggatcagaagatcaccaagagcaccaccaagtacgcgctgcgtcaggcg
ctggagggcatcgtcccggggcacgtgctccatcgggcgaagctgggcttcccggtgccg
ctgcggcactggctgcgcggcacggaattgttcgattgggcacacgagcagatcgcggcg
tcgggcaccgatcacctgctcgacaaggccgcgatcacgaagatgctgaacgaccaccgg
gacggggtgtccgaccacagccgtcgcctgtggaccgtgctgatcttcatggtctggcac
ggcatcttcgtcgagaaccgcatcgttccggagatcgccgagccggcgtacccggtctcg
ctgtag

DBGET integrated database retrieval system