KEGG   Rhodococcus jostii: RHA1_ro01151Help
Entry
RHA1_ro01151      CDS       T00382                                 

Definition
(RefSeq) dihydrolipoamide acetyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rha  Rhodococcus jostii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHA1_ro01151
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RHA1_ro01151
  Amino acid metabolism
   00310 Lysine degradation
    RHA1_ro01151
Enzymes [BR:rha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RHA1_ro01151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1224564..1226294
Genome map
AA seq 576 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPVAGVLSKIV
AQEDDTVEIGGELAVIGDAGEAPASDSAPAPAAEEPAAEPAPAAEAPADEPAPAASGNGS
AEGTAVKMPELGESVTEGTVTRWLKAVGDEVAVDEPLVEVSTDKVDTEIPSPVAGTLLEI
SAEEDDTVSVGGQLAVIGSGAPAAKPAAEPKPEPTPEPAPAPEPAKPEPAKSAPAPAAAP
AASAPAPAAAAPAPAATSGDSTPYVTPLVRKLAADNSVDLSSVTGTGVGGRIRKQDVLAA
AEAKKAPAAAAAPAAAPAAAAAPAAASAGVRPELAHLRGTTQKANRIRQITATKTRESLQ
STAQLTQTFEVDVTKIAALRAQAKNTFVEREGVKLTFLPFFAKAVVEALKSHPNINASYD
EANKQITYYDAEHLGIAVDTDQGLLSPVIHNAGDLSLAGLARAIADIAKRARSGGLKPDE
LSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPVVVTDESGSESIGVRSMCYL
PLTYDHRLVDGADAGRFLTTIKQRLEQGAFEADLGL
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccagcgcttggtgagagtgtcaccgagggaactgtcacg
cggtggctcaagcaggaaggagacacggtcgaagttgacgaacccttgctcgaagtctcc
acggacaaggtggacacggaaatcccgtctcccgtggccggcgttctcagcaagatcgtt
gctcaggaagacgacaccgtggaaatcggtggcgagcttgccgtgatcggcgacgccggt
gaggctcctgcctccgactccgctcccgcacccgccgccgaagagcccgccgccgagccg
gctcccgccgcggaggcgccggccgacgagcctgcgcccgcagcatccggcaacggttcc
gccgagggcaccgccgtgaagatgcccgaactgggcgagtccgtcaccgagggcaccgtc
acccgctggctcaaggccgtcggcgacgaggttgccgtggacgagccgctcgtcgaggta
tccaccgacaaggtcgacacggagatcccgtcccccgtcgccggtactctcctcgagatc
agcgccgaggaagacgacaccgtctccgtcggcggtcagctcgccgtcatcggttcgggt
gcacccgccgccaagccggccgcggaaccgaagcccgagccgacccccgagcccgctccg
gcccccgagcccgcgaagcccgaacccgcgaagagtgccccagccccggccgccgcaccg
gcagcatccgcaccggctcccgcagccgccgcgcccgctcccgcggccacgtccggagac
agcaccccgtacgtcactccgctggtgcgcaagctcgctgcggacaacagcgtcgatctg
tcctcggtgacgggcaccggagtcggtggccgtatccgtaagcaggacgtcctcgccgcc
gccgaggccaagaaggcaccggccgccgctgccgcgcctgctgccgcaccggccgccgcc
gctgctcccgcagccgcctccgccggggtccgccccgaacttgcccacctgcgcggaacc
acgcagaaggccaaccggattcgccagatcaccgccacgaagacgcgggagtcgctgcag
tccacggcgcagctcacccagaccttcgaggtcgacgtcaccaagatcgcggccctgcgc
gcgcaggccaagaacaccttcgtcgagcgcgagggcgtcaagctcacgttcctcccgttc
ttcgcgaaggccgtcgtcgaggcgctgaagtcgcacccgaacatcaacgccagctacgac
gaggcgaacaagcagatcacgtactacgacgccgagcacctcggcatcgcggtcgacacc
gaccagggcctgctgtcccccgtgatccacaacgccggcgacctgtcgctggccggactg
gcccgcgctatcgcggacatcgccaagcgcgcccgctccggtgggctcaagccggacgag
ctgtccggtggcacgttcacgatcacgaacatcggcagccagggcgccctgttcgacacc
ccgatcctcgtgcccccgcaggccgcgatgctcggaaccggtgcgatcgtcaagcgtccc
gtggtcgtgaccgacgagtccggcagtgaaagcatcggtgtccgctcgatgtgctacctg
ccgctcacctacgatcaccgcctcgtcgacggtgccgacgccggccgcttcttgaccacg
atcaagcagcgtctggagcagggagcgttcgaggccgacctcgggctctga

DBGET integrated database retrieval system