KEGG   Rhodococcus jostii: RHA1_ro01295Help
Entry
RHA1_ro01295      CDS       T00382                                 

Definition
(GenBank) probable phosphoglycerate mutase
  KO
K22306  glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
rha  Rhodococcus jostii
Brite
Enzymes [BR:rha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     RHA1_ro01295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABG93119
UniProt: Q0SH67
Position
complement(1365850..1366509)
Genome map
AA seq 219 aa AA seqDB search
MTDAPRAPRRLILLRHGQTEYNADNRMQGQLDTELSELGRSQARAAASALVGRRPISIVS
SDLRRAYDTAVEVGDNAGLPVQIDERLRETHLGDWQGLTHLDVDARAPGARATWRGDATW
APPGGESRIDVARRSKPVVAELVEKHEDWAEKPVVLVAHGGLIAALTAALLDLPVDRWPV
LGGLGNTSWVQLSAYGNPDSLNWRLDVWNASASVASDVL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgacggatgccccccgtgccccgcgacgtctgatcctgctccgccacgggcagaccgag
tacaacgccgacaaccgcatgcagggacagctcgacaccgaactgtcggagctgggtcgg
tcgcaggcccgcgccgcagccagcgcactcgtcggtcgcagaccgatctccatcgtgtcg
tccgatctgcggcgggcctacgacaccgcggtcgaggtcggtgacaatgccggtctgccg
gtgcagatcgacgagcgcctccgcgagacgcatctcggtgactggcaggggctcacgcac
ctcgacgtcgacgcgcgcgcacccggcgcccgcgccacgtggcgcggcgacgcgacgtgg
gcaccgcccggcggggagagtcgcatcgacgtcgcacgccgcagcaagccggtggtcgcc
gaactcgtggagaagcacgaggactgggcggagaagccggtggtcctggtcgcgcacggc
ggtttgatcgccgcgctgactgccgcactgctggatctgcccgtcgaccgctggccggtg
ctgggcgggctggggaacaccagctgggtgcagctgagtgcgtacggaaaccccgattcg
ctcaactggcgcctcgacgtgtggaacgcttctgcgagtgtggccagtgacgtcctctga

DBGET integrated database retrieval system