KEGG   Rhodococcus jostii: RHA1_ro01295Help
Entry
RHA1_ro01295      CDS       T00382                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rha  Rhodococcus jostii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHA1_ro01295
   01230 Biosynthesis of amino acids
    RHA1_ro01295
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHA1_ro01295
  Energy metabolism
   00680 Methane metabolism
    RHA1_ro01295
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHA1_ro01295
Enzymes [BR:rha01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RHA1_ro01295
Exosome [BR:rha04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RHA1_ro01295
  Exosomal proteins of melanoma cells
   RHA1_ro01295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1365850..1366509)
Genome map
AA seq 219 aa AA seqDB search
MTDAPRAPRRLILLRHGQTEYNADNRMQGQLDTELSELGRSQARAAASALVGRRPISIVS
SDLRRAYDTAVEVGDNAGLPVQIDERLRETHLGDWQGLTHLDVDARAPGARATWRGDATW
APPGGESRIDVARRSKPVVAELVEKHEDWAEKPVVLVAHGGLIAALTAALLDLPVDRWPV
LGGLGNTSWVQLSAYGNPDSLNWRLDVWNASASVASDVL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgacggatgccccccgtgccccgcgacgtctgatcctgctccgccacgggcagaccgag
tacaacgccgacaaccgcatgcagggacagctcgacaccgaactgtcggagctgggtcgg
tcgcaggcccgcgccgcagccagcgcactcgtcggtcgcagaccgatctccatcgtgtcg
tccgatctgcggcgggcctacgacaccgcggtcgaggtcggtgacaatgccggtctgccg
gtgcagatcgacgagcgcctccgcgagacgcatctcggtgactggcaggggctcacgcac
ctcgacgtcgacgcgcgcgcacccggcgcccgcgccacgtggcgcggcgacgcgacgtgg
gcaccgcccggcggggagagtcgcatcgacgtcgcacgccgcagcaagccggtggtcgcc
gaactcgtggagaagcacgaggactgggcggagaagccggtggtcctggtcgcgcacggc
ggtttgatcgccgcgctgactgccgcactgctggatctgcccgtcgaccgctggccggtg
ctgggcgggctggggaacaccagctgggtgcagctgagtgcgtacggaaaccccgattcg
ctcaactggcgcctcgacgtgtggaacgcttctgcgagtgtggccagtgacgtcctctga

DBGET integrated database retrieval system