KEGG   Rhodococcus jostii: RHA1_ro01310Help
Entry
RHA1_ro01310      CDS       T00382                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
rha  Rhodococcus jostii
Pathway
rha00330  Arginine and proline metabolism
rha00332  Carbapenem biosynthesis
rha01100  Metabolic pathways
rha01130  Biosynthesis of antibiotics
rha01230  Biosynthesis of amino acids
Module
rha_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RHA1_ro01310 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    RHA1_ro01310 (proB)
Enzymes [BR:rha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     RHA1_ro01310 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABG93134
UniProt: Q0SH52
Position
complement(1381488..1382588)
Genome map
AA seq 366 aa AA seqDB search
MSATRRTIASAGSIVVKIGSSALTSLVGGLDVGRLDALADAIEDRMRAGSDVVVVSSGAV
GAGLAPLGLTKRPRDLATKQAAASVGQLALAHAWGTSFARYGRTVGQVLLTADDIARRAQ
HRNAQRTLDRLRALHAVAIVNENDTVATAELRFGDNDRLAALVAHLVGADALVLLSDVDG
LYDGDPRKGNATLIPEVNSPEDLDGVVAGSGGALGTGGMASKLSAARLAADAGVPVLLAA
ASDAGAALRDAGVGTAFVARPSRLSARKFWVRHAADEQGILHIDEGAVRAVVTKRRSLLP
AGISAVSGRFYGGDVVSLLGPDERPVARGVVAYDSAEISDILGKSTQELPAEMQRPVVHA
DDLVPL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccacccggcgcacgatcgcgtcggcgggcagcattgtcgtgaagatcggctcg
tccgcgctgaccagcctggtcggcgggctcgacgtcggtcgactcgacgcgctggccgat
gcgatcgaggatcggatgcgtgccggttccgacgtggtcgtcgtgtcgtcgggggccgtg
ggcgcgggtctggccccgctggggctgaccaagcggccacgggacctggcgacgaagcag
gccgccgcgagcgtcggccagctggcactggcccatgcctggggcacgtcgttcgcccgg
tacggccgcaccgtcgggcaggtgctgctcaccgcagacgacatcgcccgccgcgcgcag
caccgcaacgcgcaacgcaccctcgaccgtctgcgcgcgctgcacgcggtcgcgatcgtc
aacgagaacgacaccgtcgccacggcggagctgcgattcggtgacaacgaccggctcgcc
gcgctcgtcgcgcacctggtcggcgccgatgccctggtcctgctctcggatgtcgacggg
ctgtacgacggcgacccccgcaagggcaatgccacgctgattcccgaggtgaacagcccc
gaggatctcgacggggtggtcgcgggctcgggcggcgctctcggcaccggcgggatggcg
tccaagctgtcggcagcgcgcctcgcggccgatgccggcgtgcccgtactgctcgccgcc
gcctcggacgccggggcagcgctgcgggacgccggggtgggaacggcgttcgtggcccgg
ccgtcccggttgtcggcgcgcaagttctgggtacgccacgccgcggacgagcaggggatc
ctgcacatcgacgagggcgctgtgcgtgccgtcgtcaccaagcggcggtcgttgctgccc
gcggggatcagcgcggtctcggggaggttctacggcggcgacgtcgtgtcgctcctcggc
cccgacgagcgacccgtggccaggggagtggtggcgtacgactcggcggagatcagcgac
atcctgggtaagtcgacccaggaactgcccgcggagatgcagcgccccgtcgtccacgcg
gacgatctggtgccgctctga

DBGET integrated database retrieval system