KEGG   Rhodococcus jostii: RHA1_ro01359Help
Entry
RHA1_ro01359      CDS       T00382                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rha  Rhodococcus jostii
Pathway
rha00010  Glycolysis / Gluconeogenesis
rha00052  Galactose metabolism
rha00500  Starch and sucrose metabolism
rha00520  Amino sugar and nucleotide sugar metabolism
rha00521  Streptomycin biosynthesis
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
Module
rha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rha_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHA1_ro01359
   00052 Galactose metabolism
    RHA1_ro01359
   00500 Starch and sucrose metabolism
    RHA1_ro01359
   00520 Amino sugar and nucleotide sugar metabolism
    RHA1_ro01359
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RHA1_ro01359
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    RHA1_ro01359
Enzymes [BR:rha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RHA1_ro01359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG DEDD_Tnp_IS110 FGGY_N Hydant_A_N Pan_kinase DGOK OrfB_IS605 TCR
Motif
Other DBs
NCBI-ProteinID: ABG93183
UniProt: Q0SH03
Position
1433605..1434606
Genome map
AA seq 333 aa AA seqDB search
MSTVPSVPASAHTVGIDVGGTSIRACVVDETGEVLDSVQAPTPQSAKALEDALDRAVREL
ASRHRIAAVGLAVAGFISSDLTTVRFAPHLPWKNVPVANDLSDRLGLPVVLEHDANAAAW
AEHRFGAAAGGRNVVMVAIGTGIGAALLIDGTLYRGSYGVAPELGHLQVVPGGRPCACGK
RGCWERYCSGTALVDTAIELLAADPTSSTVLAREVASDPGSLTGRRIASAARDGDPLAVR
TMEEFARWLGVGLAMVGDVYDPDLVVVSGGVSGSAPLFLDHARDVYASLATGSGHRPLAR
IRETQLGESAQRIGAATMARDALLNGAPLPVRG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccgtcccctccgtgcctgcttccgctcacaccgtcggcatcgacgtcggtggt
accagtatccgtgcctgcgtggtcgacgagaccggcgaggtgctcgactccgtccaggca
cccacgccgcagtcggcgaaagccctcgaggacgcgctcgaccgcgccgtccgcgagctc
gcgtcccgtcatcggatcgccgccgtcggtctcgccgtggcgggattcatcagttccgac
ctcaccaccgtgcgcttcgccccgcacctgccgtggaagaacgtgccggtcgcgaacgac
ctgagcgaccggctcggactgccggtggtcctcgaacacgacgcgaacgcggcggcgtgg
gcggagcaccggttcggcgctgccgccggtggtcgcaatgtcgtgatggtcgcgatcggc
accggtatcggtgcggcgctgctcatcgacggcaccctgtaccggggcagttacggcgtc
gctcccgaactgggccacctccaggtggtgccgggcggcagaccgtgcgcctgcggtaaa
cgggggtgctgggaacggtattgcagcggaaccgcgctcgtcgacacggccatcgaactc
ctcgccgccgacccgacgagttcgacggtgctcgcacgcgaggtcgcgagcgatccaggc
tcgctcaccggccgccgcatcgcgagcgccgcgcgggacggtgacccgctcgccgtgcgc
accatggaggagttcgcacggtggctgggcgtcggactcgccatggtcggtgacgtctac
gaccccgatctcgtcgtcgtctccggtggcgtcagcggctctgctccgctgttcctcgac
cacgcgcgcgacgtctacgcctctcttgcaaccggttccggacaccgccccctcgcccgc
atccgcgaaacccaactcggcgaatcggcccagcggatcggggccgccacgatggcaagg
gacgcgctgctgaacggagctccgctccccgtgcgtggttga

DBGET integrated database retrieval system