KEGG   Rhodococcus jostii: RHA1_ro01487Help
Entry
RHA1_ro01487      CDS       T00382                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rha  Rhodococcus jostii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RHA1_ro01487 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHA1_ro01487 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RHA1_ro01487 (thrC)
Enzymes [BR:rha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RHA1_ro01487 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1568489..1569571)
Genome map
AA seq 360 aa AA seqDB search
MTGTRNPVHTPWPGLIEAYRDRLAIGPNWKTVTLREGGTPLLPAGHLSELTGCDVYLKVE
GLNPTGSFKDRGMTMAVTDALARGQQAVLCASTGNTSASAAAYAAKAKMTCAVLVPQGKI
AMGKLAQAVMHGARIIQVQGNFDDCLELARKTTAEFPTIGLVNSVNPVRIEGQKTAAFEI
CDALGKAPDVHALPVGNAGNITAYWRGYSEYYADGLTSVKPRMLGVQAAGAAPLVHGAPV
KDPETIATAIRIGSPASWNGAVTAKEESHGAFRAATDDEILEAYRLIARTEGVFVEPASA
ASVAGLLAARKEGWLDSGLTVVCTVTGNGLKDPDTALAGMPDVQPIPVDPVAVASALELA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcacccgtaaccccgttcacaccccctggccggggctgatcgaggcttaccgc
gaccgcctcgccatcggaccgaactggaagacggtcaccctgcgcgagggcggcaccccg
ctgctgcccgccgggcacctgtcggagctcaccggttgcgacgtctacctgaaggtcgag
gggctcaacccgaccggttcgttcaaggaccgcggcatgacgatggccgtcaccgacgcg
ctggcccgcggtcagcaggccgtcctgtgtgcgtccacgggtaacacgtccgcttccgcc
gccgcgtacgccgcgaaggcgaagatgacctgcgccgtgctggtgccgcagggcaagatc
gcgatgggcaagctcgcgcaggccgtcatgcacggcgcgcggatcatccaggtgcagggc
aacttcgacgactgcctcgaactggcccgcaagaccaccgcggagttccccacgatcggg
ctcgtgaactcggtcaacccggtccgcatcgagggccagaagaccgcggcattcgagatc
tgcgacgccctgggcaaggcccccgacgtgcacgcgctcccggtcggcaacgcgggcaac
atcaccgcgtactggcgcgggtactccgagtactacgcggacggactcaccagcgtgaag
ccccgcatgctcggtgtccaggccgccggcgccgcaccgctcgtccacggcgcaccggtg
aaggacccggagacgatcgcgaccgcgatccgcatcggctcgcccgcgtcctggaacggt
gcggtcaccgccaaggaagagtcgcacggcgccttccgggccgcgaccgacgacgagatc
ctcgaggcgtaccggctgatcgccaggaccgaaggggtgttcgtcgaacccgcctcggcc
gcgagcgtcgcgggtctgctcgccgcccgcaaggagggctggctggactcgggcctgacc
gtcgtgtgcacggtcaccggcaacggtctcaaggaccccgacacggcgctggcgggtatg
cctgatgttcaaccgatcccggtcgatcctgtcgctgtcgcgtctgccctcgagctggcg
tag

DBGET integrated database retrieval system