KEGG   Rhodococcus jostii RHA1: RHA1_ro01493Help
Entry
RHA1_ro01493      CDS       T00382                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
rha  Rhodococcus jostii RHA1
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rha00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1575800..1578352)
Genome map
AA seq 850 aa AA seqDB search
MPIGLANRSAWVVGSTKSVPLLRGLAPVAARTRLVSGGRGRSRTPGEASRMTDGPQLGSQ
DPDGHYSDSDLELDLRWWAAANYLTVAQIYLQDNALLREPLRPEHIKPRLLGHWGTSPGL
SMIYALLNRLIRRTDTDCLYVTGPGHGGPALVAATYLEGTYSEVYPGVSRDAAGIHRLCR
QFSTPGGIPSHVSVQTPGSIHEGGELGYALAHAAGAAFDHPNLLVACVIGDGEAETGPLS
GSWKLPAFLNPERDGAVLPILHVNGAKIAGPTVYGRSSDADIEAFLGGQGWAPTVVSGDD
PRQVFPALHRALTDAHTAISDLQREARAGRRSAAKWPAIVLRTPKGWTGPRTVDGVLVEG
THRAHQVPLSGVRTDEAHLRQLEEWMRSYRPDALFDSSGALFADLERLAPQGDKRMGSSP
YANGGRLRADLPVPPLEKYALAIEKPGTTHHETTRVLGELLRDLYAATTTPDGGGYFRLF
CPDETSSNRLGAVFEVTDRCWQLPVTDHDDGLSARGRVMEVLSEHLCEGWLEGYLLSGRH
GLFASYEAFAMVSVSMLIQHTKWLQHAVDLPWRAPVASLNVLLTSTCWRNDHNGFSHQGP
GMIDAVIPLAPDVVRIWLPPDSNTLLSISDHCLRSTDHVNLIVVDKQPHLQYLTLAEAHA
HCAAGASVWAWAGTEAAAGADLDVVLAAAGDVPTQEILAAAQLLREHTPELVTRVVNVVD
LMGLLTPTEHPHGFDARMFLDLFTADTDVVFAFHGYSRAVHELIHGRPTPDRFHVRGFSE
QGTTTTPFDMVVLNRMSRYHLVLEALRRTRREPSGAGELADFCLRQLERHGEYVVAHLED
MPEVRDWTWS
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
gtgccgattgggctggccaatcgtagcgcatgggtagtgggatcgaccaaatcggtcccc
ctacttcgtggactcgccccggtagcggcccggacacgcctagtgtcgggaggacgtgga
cgctcgcgaactcccggggaggcgtcgagaatgaccgatggaccgcagttggggtcgcag
gaccccgacgggcactattccgattccgacctcgagctggacctgcggtggtgggcggcg
gccaactatctgacggtcgcgcagatctacctgcaggacaacgcgcttctgcgtgagccg
ctgcgcccggaacacatcaaaccccggctgctcgggcactgggggacgagcccgggtctg
tcgatgatctacgccctgctgaaccgtctcatccgccggaccgacaccgattgtctctac
gtgacgggtcccggacacggtggtccggcgctcgtcgccgccacgtacctggaggggacg
tactcggaggtgtatccgggtgtgtcccgcgacgcagcgggtatccaccggctctgccgg
cagttctcgaccccgggtggcatcccgagtcacgtcagtgtgcagacaccgggcagcatc
cacgagggcggcgagctcggctacgccctcgcgcatgccgccggggcggcgttcgatcac
ccgaatctgttggtggcgtgcgtgatcggagacggcgaggcagagacgggaccgctgtcc
ggttcgtggaaactccccgccttcctcaatccggaacgcgacggtgcggtgttgccgatc
ctgcacgtcaacggagcgaagatcgccgggcccaccgtctacggccgcagcagcgacgcg
gacatcgaggcattcctcggcggtcaggggtgggcgccgaccgtcgtctccggcgacgac
ccgcggcaggtcttcccggcgctgcatcgcgcactcaccgacgcgcacaccgcgatctcc
gaccttcagcgggaggcgcgggccggcaggcgcagcgccgccaagtggccggcgatcgtg
ctgcgcactccgaagggctggaccgggccgcggaccgtcgacggcgtgctcgtcgagggc
acgcaccgggcccatcaggttccgctgtcgggggtgcggaccgacgaggcgcacctgcgt
cagctcgaggagtggatgcggtcgtaccgcccggacgcactgttcgactcgtccggcgca
ctctttgcggacctcgagcggctggcgccgcagggcgacaagcggatgggttcgtcgccg
tacgcgaacggcggccgcctgcgtgcggatcttcccgtgccgccgctggagaagtacgcg
cttgcgatcgagaaacccggcaccacccaccacgagaccacccgggtgctcggggaactg
ctccgcgacctgtacgccgccaccaccacgcccgacggcggcggctacttccggctgttc
tgcccggacgaaacgtccagcaaccggttgggcgccgtgttcgaggtgaccgaccgctgc
tggcagctgccggtcaccgaccacgacgacgggctgtcggcccgcggccgggtgatggag
gtgctcagcgagcacctctgcgagggatggctcgaggggtatctgctgtcggggcggcac
gggctgttcgccagctacgaggcgttcgcgatggtgagcgtgtcgatgctcatccagcac
acgaagtggttgcagcatgcggtggatctgccgtggcgggcgccggtggcgtcgctgaac
gtcctgctgaccagcacctgctggcgcaacgaccacaacgggttcagtcatcaagggccg
ggcatgatcgacgccgtcatcccgctcgcaccggacgtcgtccggatctggctgccaccg
gactcgaacactctgctgtccatctccgaccactgcctccgcagcaccgaccacgtcaac
ctcatcgtcgtcgacaagcagccgcacctgcagtacctgaccctcgcggaggcgcacgca
cactgcgcggccggggcgtcggtgtgggcgtgggcggggacggaagccgcggcgggcgcc
gacctggacgtcgtgctcgcggccgccggggacgttccgacccaggagatcctggcggcg
gcgcagttgctgcgcgagcacacgccggaactggtcacccgggtggtcaacgtcgtcgac
ctgatggggttgctcacacccacggaacatccgcacggattcgacgcgcgcatgttcctg
gacctgttcaccgcggacacggacgtggtgttcgcgttccacgggtactcgcgcgccgtc
cacgagctgatccacgggcgtcccaccccggaccgtttccacgttcgcggcttcagcgaa
cagggcaccacgaccaccccgttcgacatggtcgtgctcaaccgtatgagccgctatcac
ctggtcctcgaggcgctgcgacgcacgcggagggaaccgtccggtgccggggaactggcc
gacttctgcctccggcaactcgaacggcacggcgaatacgtcgtcgcgcacctcgaggac
atgcccgaggtgcgcgactggacgtggtcgtga

DBGET integrated database retrieval system