KEGG   Rhodococcus jostii: RHA1_ro01493Help
Entry
RHA1_ro01493      CDS       T00382                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
rha  Rhodococcus jostii
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RHA1_ro01493
Enzymes [BR:rha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     RHA1_ro01493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1575800..1578352)
Genome map
AA seq 850 aa AA seqDB search
MPIGLANRSAWVVGSTKSVPLLRGLAPVAARTRLVSGGRGRSRTPGEASRMTDGPQLGSQ
DPDGHYSDSDLELDLRWWAAANYLTVAQIYLQDNALLREPLRPEHIKPRLLGHWGTSPGL
SMIYALLNRLIRRTDTDCLYVTGPGHGGPALVAATYLEGTYSEVYPGVSRDAAGIHRLCR
QFSTPGGIPSHVSVQTPGSIHEGGELGYALAHAAGAAFDHPNLLVACVIGDGEAETGPLS
GSWKLPAFLNPERDGAVLPILHVNGAKIAGPTVYGRSSDADIEAFLGGQGWAPTVVSGDD
PRQVFPALHRALTDAHTAISDLQREARAGRRSAAKWPAIVLRTPKGWTGPRTVDGVLVEG
THRAHQVPLSGVRTDEAHLRQLEEWMRSYRPDALFDSSGALFADLERLAPQGDKRMGSSP
YANGGRLRADLPVPPLEKYALAIEKPGTTHHETTRVLGELLRDLYAATTTPDGGGYFRLF
CPDETSSNRLGAVFEVTDRCWQLPVTDHDDGLSARGRVMEVLSEHLCEGWLEGYLLSGRH
GLFASYEAFAMVSVSMLIQHTKWLQHAVDLPWRAPVASLNVLLTSTCWRNDHNGFSHQGP
GMIDAVIPLAPDVVRIWLPPDSNTLLSISDHCLRSTDHVNLIVVDKQPHLQYLTLAEAHA
HCAAGASVWAWAGTEAAAGADLDVVLAAAGDVPTQEILAAAQLLREHTPELVTRVVNVVD
LMGLLTPTEHPHGFDARMFLDLFTADTDVVFAFHGYSRAVHELIHGRPTPDRFHVRGFSE
QGTTTTPFDMVVLNRMSRYHLVLEALRRTRREPSGAGELADFCLRQLERHGEYVVAHLED
MPEVRDWTWS
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
gtgccgattgggctggccaatcgtagcgcatgggtagtgggatcgaccaaatcggtcccc
ctacttcgtggactcgccccggtagcggcccggacacgcctagtgtcgggaggacgtgga
cgctcgcgaactcccggggaggcgtcgagaatgaccgatggaccgcagttggggtcgcag
gaccccgacgggcactattccgattccgacctcgagctggacctgcggtggtgggcggcg
gccaactatctgacggtcgcgcagatctacctgcaggacaacgcgcttctgcgtgagccg
ctgcgcccggaacacatcaaaccccggctgctcgggcactgggggacgagcccgggtctg
tcgatgatctacgccctgctgaaccgtctcatccgccggaccgacaccgattgtctctac
gtgacgggtcccggacacggtggtccggcgctcgtcgccgccacgtacctggaggggacg
tactcggaggtgtatccgggtgtgtcccgcgacgcagcgggtatccaccggctctgccgg
cagttctcgaccccgggtggcatcccgagtcacgtcagtgtgcagacaccgggcagcatc
cacgagggcggcgagctcggctacgccctcgcgcatgccgccggggcggcgttcgatcac
ccgaatctgttggtggcgtgcgtgatcggagacggcgaggcagagacgggaccgctgtcc
ggttcgtggaaactccccgccttcctcaatccggaacgcgacggtgcggtgttgccgatc
ctgcacgtcaacggagcgaagatcgccgggcccaccgtctacggccgcagcagcgacgcg
gacatcgaggcattcctcggcggtcaggggtgggcgccgaccgtcgtctccggcgacgac
ccgcggcaggtcttcccggcgctgcatcgcgcactcaccgacgcgcacaccgcgatctcc
gaccttcagcgggaggcgcgggccggcaggcgcagcgccgccaagtggccggcgatcgtg
ctgcgcactccgaagggctggaccgggccgcggaccgtcgacggcgtgctcgtcgagggc
acgcaccgggcccatcaggttccgctgtcgggggtgcggaccgacgaggcgcacctgcgt
cagctcgaggagtggatgcggtcgtaccgcccggacgcactgttcgactcgtccggcgca
ctctttgcggacctcgagcggctggcgccgcagggcgacaagcggatgggttcgtcgccg
tacgcgaacggcggccgcctgcgtgcggatcttcccgtgccgccgctggagaagtacgcg
cttgcgatcgagaaacccggcaccacccaccacgagaccacccgggtgctcggggaactg
ctccgcgacctgtacgccgccaccaccacgcccgacggcggcggctacttccggctgttc
tgcccggacgaaacgtccagcaaccggttgggcgccgtgttcgaggtgaccgaccgctgc
tggcagctgccggtcaccgaccacgacgacgggctgtcggcccgcggccgggtgatggag
gtgctcagcgagcacctctgcgagggatggctcgaggggtatctgctgtcggggcggcac
gggctgttcgccagctacgaggcgttcgcgatggtgagcgtgtcgatgctcatccagcac
acgaagtggttgcagcatgcggtggatctgccgtggcgggcgccggtggcgtcgctgaac
gtcctgctgaccagcacctgctggcgcaacgaccacaacgggttcagtcatcaagggccg
ggcatgatcgacgccgtcatcccgctcgcaccggacgtcgtccggatctggctgccaccg
gactcgaacactctgctgtccatctccgaccactgcctccgcagcaccgaccacgtcaac
ctcatcgtcgtcgacaagcagccgcacctgcagtacctgaccctcgcggaggcgcacgca
cactgcgcggccggggcgtcggtgtgggcgtgggcggggacggaagccgcggcgggcgcc
gacctggacgtcgtgctcgcggccgccggggacgttccgacccaggagatcctggcggcg
gcgcagttgctgcgcgagcacacgccggaactggtcacccgggtggtcaacgtcgtcgac
ctgatggggttgctcacacccacggaacatccgcacggattcgacgcgcgcatgttcctg
gacctgttcaccgcggacacggacgtggtgttcgcgttccacgggtactcgcgcgccgtc
cacgagctgatccacgggcgtcccaccccggaccgtttccacgttcgcggcttcagcgaa
cagggcaccacgaccaccccgttcgacatggtcgtgctcaaccgtatgagccgctatcac
ctggtcctcgaggcgctgcgacgcacgcggagggaaccgtccggtgccggggaactggcc
gacttctgcctccggcaactcgaacggcacggcgaatacgtcgtcgcgcacctcgaggac
atgcccgaggtgcgcgactggacgtggtcgtga

DBGET integrated database retrieval system