KEGG   Rhodococcus jostii RHA1: RHA1_ro01517Help
Entry
RHA1_ro01517      CDS       T00382                                 

Definition
3'-phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rha  Rhodococcus jostii RHA1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rha00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1600473..1601603)
Genome map
AA seq 376 aa AA seqDB search
MITDARLAADIASGAGALLLDIRTAGLGSADGRELGRRGDVAADAFILGKLSAERPDDAI
LSEESADDRSRLESSRVWIIDPLDGSKEYGLPGHSDWAVHVALWERGRGITAAAVAQPAL
GAVYASDDDSHAVHTEQLPARPRIVVSASRPPAFVDAVATEIGAEVTTMGSAGAKAMAVL
RGDVDAYIHAGGQWEWDSAAPVGVAEAAGLHCSRIDGTPLDYNESHPYLPDLLICRPELA
RPLLAAIATHATDTADSGRVAMARAYIDALVSHDATKVRLADNAWRVENGQHTGESGAFI
RDELENGLQYQAIQAVRELSFHEWGDNVVARFVLDLGATPTEVTSVRITEHFDIPAGAIQ
SVMAIIEPSAIERENR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgatcactgacgcacgactcgcggccgacatcgcctccggtgccggtgccctgctgctg
gacatccgcaccgcgggactcggatcggcggacggtcgtgaactgggcaggcggggcgac
gtcgccgccgacgcgttcattctcggcaagctctccgcggagcgacccgacgacgcgatc
ctctccgaggagtccgccgacgaccggtcgcggctggagagttcccgggtgtggatcatc
gacccgctcgacggttccaaggagtacggactgcccggtcactcggattgggcggtgcac
gtcgcactgtgggaacgcggccggggcatcacggcggcagcggtcgcgcaaccggcactg
ggtgcggtgtatgccagtgacgacgacagccacgcggtgcataccgaacagctcccggca
cgaccacggatcgtcgtgtccgcgagcaggccgcccgccttcgtcgacgccgtcgcgacg
gagatcggtgccgaggtcaccaccatgggttcggccggagcgaaggcgatggccgtgctt
cgtggggacgtggacgcctacatccacgcgggtgggcagtgggaatgggactcggccgcc
cccgtcggcgtcgccgaggctgcgggcctgcactgctcgcggatcgacggaactccgttg
gattacaacgagtcccacccctacctgcccgacctcctgatctgccgaccggagctggct
cggccgctgctcgccgcgatcgcgacacacgccaccgacacggccgacagcggccgggtc
gcgatggccagggcctatatcgatgcgctggtcagccacgacgccaccaaggtgcgtctc
gcggacaatgcatggcgcgtggagaacgggcagcatacgggcgaatcgggggccttcatc
cgggacgaactcgagaacggcctgcagtatcaggccatccaggccgtgcgcgaactctcc
ttccacgagtggggtgacaacgtggtggcgcggttcgtgctcgatctcggcgccacgccc
accgaggtgacgtccgtccggatcacggaacacttcgacatcccggccggggcgatccag
tccgtcatggccatcatcgaaccgtccgcgatcgaaagggagaaccgatga

DBGET integrated database retrieval system