KEGG   Rhodococcus jostii RHA1: RHA1_ro01568Help
Entry
RHA1_ro01568      CDS       T00382                                 

Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
rha  Rhodococcus jostii RHA1
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Purine degradation, xanthine => urea
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rha00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1652417..1653310
Genome map
AA seq 297 aa AA seqDB search
MSKIVLGQNQYGKAEVRLVKITRDTKRHEIEDVTVTSQLRGDLDAVHTEGDNAHVVATDT
QKNTVYAFARDGVGSIETFAMRLGQHFTGEFEWITGGRWEIEQYSWARIPVDGEGHDHSF
VRSSDERRNTVVTMDGDRTWIVSGLSNMVVLKSTGSEFRGYPKDKYTTLQETSDRILATS
VSARWRYLTTDVDFDKTFENVRAIMLEAFATTHSLALQQSLFQMGSAVLEAHPEIAEVKF
SMPNKHHFLVDLEPFGLDNPGEVFFAADRPYGLIEATVEREDAPDAGRAWDSVPGFC
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatcgtgctcggccagaaccagtacggcaaggcagaagtccggttggtcaag
atcacccgggacacgaagcgacacgagatcgaagacgtcaccgtgacgtcgcaactgcgc
ggcgacctcgacgcggtgcacaccgaaggcgacaacgcgcacgtcgtggccacggacacc
cagaagaacacggtgtacgcgttcgcccgcgacggcgtcggctcgatcgagacgttcgcc
atgcggctcggacagcacttcacaggggaattcgagtggatcaccggcggccggtgggag
atcgagcagtactcgtgggcgcggatcccggtcgacggcgagggccacgaccattccttc
gtccgatcgagcgacgaacggcgaaacaccgtggtcaccatggacggcgatcggacgtgg
atcgtgtccggtctcagcaacatggtggtgttgaagtcgacgggctcggagttccggggc
tacccgaaggacaagtacaccacgctgcaggagacgtccgaccggatcctcgccacgtcg
gtgagcgcccggtggcgttacctcaccaccgacgtcgacttcgacaagaccttcgagaac
gtgcgggcaatcatgctggaggccttcgccacgacgcattcgctcgcgctgcagcagtcc
ctgttccagatgggttcggcggtactcgaggcgcaccccgagatcgccgaggtgaagttc
tcgatgccgaacaaacaccacttcctcgtcgacctggaaccgttcggactcgacaacccc
ggcgaggtgttcttcgcggccgaccgcccctacgggttgatcgaggcgaccgtcgagcgc
gaggacgctcccgacgccggccgcgcctgggattccgttcccggattctgctag

DBGET integrated database retrieval system