KEGG   Rhodococcus jostii: RHA1_ro01825Help
Entry
RHA1_ro01825      CDS       T00382                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rha  Rhodococcus jostii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RHA1_ro01825
Enzymes [BR:rha01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     RHA1_ro01825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1930141..1931040
Genome map
AA seq 299 aa AA seqDB search
MVPFPALTATGAGRLLDALARDVPLVCGIVNVTPDSFSDGGRYLDTAAAVEHALSLVAEG
ADLLDVGGESTRPGSRPPSVAEEIARVVPVVAALAMSTSVPISVDTSRPDVMREAVTVGA
SMINDVRALRLPGALRTAADLDVPVCLMHMRGEPETMQRSPEYDDVVSEVRRFLVDRVGA
CRGAGIPLEHIMVDPGFGFGKTLAHNLALLSELRQITDLGVPVMAGLSRKGMLGTITGRG
VEHRQAASVAAALIAAQNGAAVLRVHDVAATVDAVSVLRALVYRGPASFSHASNRVSAL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggttccgttccccgcactcaccgccaccggcgccggtcgactgctcgacgccctcgca
cgcgacgttcccctggtctgcggcatcgtcaacgtgaccccggattcgttctccgacggt
ggtcggtacctcgacaccgccgccgcggtcgaacacgccctgtcgctggtcgcagagggc
gccgacctcctcgacgtcggcggcgagtcgacccgtcccgggtcccgcccgccgtccgtc
gcggaggagatcgcgcgcgtggtgccggtagttgcggccctcgcgatgtcgacgtcggta
ccgatctccgtcgacacctcgagaccggacgtcatgcgagaggcggtcaccgtcggcgcg
tcgatgatcaacgacgttcgcgccctccggcttccgggtgcactgcggaccgcggccgat
ctggacgtgccggtgtgcctgatgcacatgcgcggcgagcccgaaacgatgcagaggtcg
ccggagtacgacgacgtcgtgtccgaggtgcgccggttcctcgtcgaccgtgtcggcgcc
tgccggggcgcgggaattccgctcgagcacatcatggtcgacccgggtttcggcttcggc
aagaccctcgcccacaacctcgcgctgttgtccgagctgcggcagatcaccgatctcggt
gttcccgtgatggccggactgtcccggaagggcatgctgggcacgatcaccggtcgcggc
gtcgagcaccgtcaggccgcctcggtggccgctgccctgattgccgcgcagaacggggca
gccgtcctccgggtgcacgacgtcgccgccaccgtggacgcggtgtccgtgctccgcgca
ctcgtatatcgtggtcccgccagcttcagtcacgcgtcgaatcgagtctccgcactgtga

DBGET integrated database retrieval system