KEGG   Rhodococcus jostii: RHA1_ro01836Help
Entry
RHA1_ro01836      CDS       T00382                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
rha  Rhodococcus jostii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rha00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RHA1_ro01836
Enzymes [BR:rha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     RHA1_ro01836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1939193..1941061)
Genome map
AA seq 622 aa AA seqDB search
MTEVQVAQRGKGMLRVFNEAGVLAAADVHVALRLSALGGESSEDVVLATALAVRAVRSGS
VCLDLTRLREVTVDEESEVDLDALPWPDDGIVVEALRRSPLVTGGSAGPLRPLRLVDTAD
GGLLYLDRYFRQEATLRRVLDQRAVGHPPVDEQSLREGLDALFRDQHDDGASAPAPDRQR
IAAAVAATQWTSVVVGGPGTGKTHTVARVLALLTRQPGPGLRIALAAPTGKAAARLQESV
REQSDALGLPPDLTAMTLHRLLGWQRGRGSRFRYNANNHLPYDAIVVDETSMVSLTMMCR
LLEAVRPDTRLVLVGDPDQLTSVDAGAVLADLVARPVTGTENPVLARIVGADLEAADDPL
EAALSAGERDRLRGGVVRLSRGRRFGGGIAQLAVAVRKGEPDEVMKILSSGFPEVSFHSP
EDLDALRADVVGTAAAVTAAAESGDAFAALRHSEGHRLLCAHREGPYGVQRWTRQAMEWI
GETIGQRLNPDRWYPGQPLMVTANDHETKIYNGDTGVIVRRDDVELVAAFVRGNEPFLLH
PTHLSAVQTVYAMTIHRSQGSQYDTVSVVLPGEASSLLTRELLYTAITRARKHVRIIGSE
DAVRAGVQRRVLRASGLRRVIP
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggtgcaggtggcgcagcgcggcaagggaatgctgcgggtgttcaacgaggcc
ggtgtgctcgccgccgcggacgtgcacgtcgcgttgcggttgtcggcgctcggaggcgaa
tcctcggaagacgtcgtactggccaccgcgctggcggtgcgcgcggtgcggtccggctcg
gtgtgcctggacctgacgcggctccgtgaggtgaccgtcgacgaggagtccgaagtcgat
ctcgacgcactaccctggccggacgacggcatcgtcgtcgaggcactgcggcggagcccg
ctggtcaccggtggttcggcgggtccgctgcggccgctgcggctcgtcgacacggccgac
ggcggactgctctacctcgaccggtacttccggcaggaagcgaccctccggcgggtactc
gaccagcgcgccgtcgggcatccccccgtcgacgagcagtcgctgcgggagggcttggac
gcgttgttccgcgaccagcacgacgacggggcgtcggctccggcaccggaccggcagcga
atcgccgccgcggtggccgccacacagtggacgtcggtggtggtcggcggacccggaaca
ggtaagacgcacaccgtcgcccgggtgctggcgctgctgacccggcagccagggccgggc
ctccggatcgcgctcgccgcacccaccgggaaagccgcggcgcggttgcaggagtcggtg
cgcgagcagtccgacgcactcgggttgccgcccgacctgaccgcgatgacgctgcaccgg
ctgctgggctggcagcgcggacgtggcagccggttccgctacaacgcgaacaatcacctg
ccctacgacgcgatcgtggtcgacgagacgtcgatggtgtcgctgacgatgatgtgccgg
ctcctcgaggcggtccgcccggacacccggttggtgctcgtcggcgaccccgatcagctg
acgtccgtcgacgcgggcgcggtcctggccgatctcgtggcccggccggtgacgggaacc
gagaatccggtgctcgccaggatcgtcggcgccgacctggaggcggccgacgacccgctc
gaggccgccttgagcgcgggggaacgggacaggttgcggggcggggtggtccggctcagc
cgcgggcggcggttcggcggcggcatcgcccagctggctgtcgcggtgcggaagggcgaa
ccggacgaggtcatgaaaatcctgtcgagcggtttccccgaggtgtcgttccacagtccg
gaagacctggacgcactgcgggcggacgtggtggggacggccgccgcggtcaccgcagct
gcggaatccggtgatgcctttgctgcactgcggcattcggaggggcaccggctgttgtgc
gcgcaccgggaaggtccgtacggcgtgcagcggtggacgcggcaggcgatggagtggatt
ggggagacgatcgggcagcggctgaacccggatcgctggtatccgggccagccgctgatg
gtgactgccaatgatcacgaaacgaagatctacaacggcgacaccggggtgatcgtgcgc
cgcgacgacgtcgaactcgtcgccgcattcgtgcggggcaacgaaccgttcctgttgcat
ccgacgcatctgtccgcggtgcagacggtgtacgcgatgacgattcaccgcagtcagggc
agccagtacgacacggtgtccgtggttcttcccggcgaggcgtcgtcgctgctgactcgc
gaattgctgtacacggcgattacccgggcacgaaagcacgtgcggatcatcgggtccgag
gatgcagtgcgggcgggagtgcaacgccgggtgctgcgggcgagtgggcttcggagggtg
attccgtag

DBGET integrated database retrieval system