KEGG   Rhodococcus jostii: RHA1_ro02051Help
Entry
RHA1_ro02051      CDS       T00382                                 

Definition
uroporphiryn-III C-methyltransferase (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
rha  Rhodococcus jostii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RHA1_ro02051
Enzymes [BR:rha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     RHA1_ro02051
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RHA1_ro02051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2163856..2165421)
Genome map
AA seq 521 aa AA seqDB search
MSRVRKNTPGRILFVGSGPGDPALLTVHARDVLAAATLAFTDPDVDKGVTVLVGTDLGVD
AETGEPLAEVRPALGEPAEVAKTLVHEARNGHDVVRLVSGDPLTTDSVIAEVTAVARTQV
QFEVLPGLPSASAVPSYAGMALGSGHTEADVRGEVDWAALAAAPGPLVLHATSGHLAETA
SALVEHGLAPQTPAAITVRGTTRQQRTVEATLATLNEAGSELVGSLVVTVGKVVAQRNKM
SWWESRALYGWKVLVPRTKDQAGEMSDRLVTHGAIPIEVPTIAVEPPRSPAQMERSVKGL
VDGRYQWVVFTSTNAVRAVWEKFEEFGLDARAFSGVKIACIGEATAAKVRSFGINPELVP
SGEQSSEGLLAEFAPYDDVFDPVNRVLLPRADIATETLAEGLRERGWEIDDVTAYRTVRA
APPPAETREMIKTGGFDAVCFTSSSTVRNLVGIAGKPHARTLVACIGPKTAETAIEFGLR
VDVQPETAQVGPLVEALAEHAARLRAEGALPPPRKKSRARR
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgagccgagtccgtaagaacacccccggacgaatcctgttcgtgggatccggaccgggc
gatccggcactgctcaccgtgcacgcacgggacgtccttgccgcagcaaccctcgccttc
accgaccccgacgtcgacaagggcgtcacggtcctggtgggcaccgacctgggcgtcgac
gccgagaccggtgagccgctcgccgaggtccgtcccgcgctgggtgagccggcggaggta
gcgaagaccctcgtccacgaggcgaggaacggccacgacgtcgtgcgtctggtgtccggc
gacccgctgaccaccgactccgtgatcgccgaggtcaccgccgtcgcccgtacccaggtg
cagttcgaggtcctgccgggcctgccgtccgcgtccgccgtcccctcctacgccggtatg
gcactgggatcggggcacaccgaggccgacgtccgcggcgaggtcgactgggccgccctg
gccgccgcacccggaccgctggtcctgcacgccacgtcgggtcacctcgccgagacggcg
agcgccctcgtcgagcacggcctggctccgcagaccccggccgccatcacggtccgcggc
accacccggcagcagcgcaccgtcgaggccacgctcgcgaccctgaacgaggccggttcc
gaactggtcggttcgctggtcgtgacggtcggcaaggtcgtcgcccagcgcaacaagatg
tcctggtgggagtcgcgcgcactgtacggctggaaggtcctggtgccgcgcaccaaggat
caggcaggcgagatgagcgaccgcctcgtcacgcacggcgccatcccgatcgaggtgccc
accatcgccgtcgagccgccccgcagcccggcgcagatggaacggtccgtcaagggcctc
gtcgacggccgctaccagtgggtggtcttcacctccaccaacgcggtgcgtgcggtgtgg
gagaagttcgaggaattcgggctcgacgcccgcgcgttctccggcgtcaagatcgcctgc
atcggcgaggccacggccgccaaggtccgctcgttcggaatcaaccccgaactcgtgccc
tccggtgagcagtcgagcgaaggcctgctggccgagttcgccccctacgacgacgtgttc
gacccggtcaaccgcgttctgctgccccgcgccgacatcgccaccgagacgctggccgag
ggcctgcgcgaacgtggctgggaaatcgacgacgtcaccgcataccgcaccgtccgggcc
gcgccgccgccggccgagacccgcgagatgatcaagaccggtgggttcgacgccgtctgc
ttcacctcgtcctcgaccgtccgcaacctcgtcggcatcgccggaaagccgcacgcgcgc
accctcgtcgcctgcatcggtccgaagaccgccgagacggccatcgagttcggcctgcgc
gtggacgtgcagccggagaccgctcaggtcggcccgctggtggaggctctcgccgagcac
gccgcgcgcctgcgtgccgagggcgcactgcccccgccgcgcaagaagtcccgcgctcgg
cgatag

DBGET integrated database retrieval system