KEGG   Rhodococcus jostii: RHA1_ro02070Help
Entry
RHA1_ro02070      CDS       T00382                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rha  Rhodococcus jostii
Pathway
rha00010  Glycolysis / Gluconeogenesis
rha00260  Glycine, serine and threonine metabolism
rha00680  Methane metabolism
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
rha01230  Biosynthesis of amino acids
Module
rha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rha_M00002  Glycolysis, core module involving three-carbon compounds
rha_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHA1_ro02070 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    RHA1_ro02070 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHA1_ro02070 (gpmA)
Enzymes [BR:rha01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RHA1_ro02070 (gpmA)
Membrane trafficking [BR:rha04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    RHA1_ro02070 (gpmA)
Exosome [BR:rha04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RHA1_ro02070 (gpmA)
  Exosomal proteins of melanoma cells
   RHA1_ro02070 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Exc
Motif
Other DBs
NCBI-ProteinID: ABG93877
UniProt: Q0SF09
Position
complement(2182177..2182932)
Genome map
AA seq 251 aa AA seqDB search
MNGMSTGTLVLLRHGESEWNALNLFTGWVDVHLTDKGIAEGKRAGELLLEHNLLPDVLYT
SLLRRAISTANIALDTADRHWIPVIRDWRLNERHYGALQGRNKAQVKEKYGDEQFMLWRR
SYDTPPPPIEAGSEYSQDTDPRYANLDKVPLTECLKDVVVRLIPYWEDTISADLKAGKTV
LITAHGNSLRALVKHLDGISDEDIAGLNIPTGIPLRYDLDENLKPLNPGGTYLDPEAAAA
GAAAVANQGGK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcatgagtaccggaacccttgtgctgctccgccacggcgagagcgaatggaat
gcgctcaacttgttcaccggctgggtggacgtccacctgaccgataagggcatcgccgag
ggcaagcgcgccggcgaattgctgctcgagcacaatctgctccccgacgtgctgtacacg
tcgctgctgcgccgcgcgatcagcaccgccaacatcgcgctcgacaccgccgaccggcac
tggattcccgtcatccgcgactggcgtctcaacgagcgtcactacggcgccctgcagggg
cgcaacaaggcgcaggtcaaggagaagtacggcgacgagcagttcatgctgtggcgccgc
agctacgacaccccgccgccgccgatcgaggcaggcagcgaatacagccaggacaccgat
ccccgctacgcgaacctcgacaaggtcccgctgacggagtgcctgaaggacgtcgtcgtc
cgcctgatcccgtactgggaggacacgatctccgccgacctgaaggccggcaagaccgtg
ctgatcaccgcgcacggcaactcgttgcgcgccctcgtcaagcacctcgacggaatctcc
gacgaggacatcgcgggcctgaacatcccgacgggcatcccgctgcgctacgacctggac
gagaacctgaagccgctcaaccccggtggcacgtacctcgaccccgaggccgccgccgcg
ggtgccgccgcggtcgcgaaccagggcgggaagtaa

DBGET integrated database retrieval system