KEGG   Rhodococcus jostii: RHA1_ro02070Help
Entry
RHA1_ro02070      CDS       T00382                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rha  Rhodococcus jostii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHA1_ro02070 (gpmA)
   01230 Biosynthesis of amino acids
    RHA1_ro02070 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHA1_ro02070 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    RHA1_ro02070 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHA1_ro02070 (gpmA)
Enzymes [BR:rha01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RHA1_ro02070 (gpmA)
Exosome [BR:rha04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RHA1_ro02070 (gpmA)
  Exosomal proteins of melanoma cells
   RHA1_ro02070 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2182177..2182932)
Genome map
AA seq 251 aa AA seqDB search
MNGMSTGTLVLLRHGESEWNALNLFTGWVDVHLTDKGIAEGKRAGELLLEHNLLPDVLYT
SLLRRAISTANIALDTADRHWIPVIRDWRLNERHYGALQGRNKAQVKEKYGDEQFMLWRR
SYDTPPPPIEAGSEYSQDTDPRYANLDKVPLTECLKDVVVRLIPYWEDTISADLKAGKTV
LITAHGNSLRALVKHLDGISDEDIAGLNIPTGIPLRYDLDENLKPLNPGGTYLDPEAAAA
GAAAVANQGGK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcatgagtaccggaacccttgtgctgctccgccacggcgagagcgaatggaat
gcgctcaacttgttcaccggctgggtggacgtccacctgaccgataagggcatcgccgag
ggcaagcgcgccggcgaattgctgctcgagcacaatctgctccccgacgtgctgtacacg
tcgctgctgcgccgcgcgatcagcaccgccaacatcgcgctcgacaccgccgaccggcac
tggattcccgtcatccgcgactggcgtctcaacgagcgtcactacggcgccctgcagggg
cgcaacaaggcgcaggtcaaggagaagtacggcgacgagcagttcatgctgtggcgccgc
agctacgacaccccgccgccgccgatcgaggcaggcagcgaatacagccaggacaccgat
ccccgctacgcgaacctcgacaaggtcccgctgacggagtgcctgaaggacgtcgtcgtc
cgcctgatcccgtactgggaggacacgatctccgccgacctgaaggccggcaagaccgtg
ctgatcaccgcgcacggcaactcgttgcgcgccctcgtcaagcacctcgacggaatctcc
gacgaggacatcgcgggcctgaacatcccgacgggcatcccgctgcgctacgacctggac
gagaacctgaagccgctcaaccccggtggcacgtacctcgaccccgaggccgccgccgcg
ggtgccgccgcggtcgcgaaccagggcgggaagtaa

DBGET integrated database retrieval system