KEGG   Rhodococcus jostii: RHA1_ro02150Help
Entry
RHA1_ro02150      CDS       T00382                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rha  Rhodococcus jostii
Pathway
rha00010  Glycolysis / Gluconeogenesis
rha00071  Fatty acid degradation
rha00350  Tyrosine metabolism
rha00625  Chloroalkane and chloroalkene degradation
rha00626  Naphthalene degradation
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHA1_ro02150
  Lipid metabolism
   00071 Fatty acid degradation
    RHA1_ro02150
  Amino acid metabolism
   00350 Tyrosine metabolism
    RHA1_ro02150
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RHA1_ro02150
   00626 Naphthalene degradation
    RHA1_ro02150
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RHA1_ro02150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ABG93957
UniProt: Q0SES9
Position
complement(2262208..2263239)
Genome map
AA seq 343 aa AA seqDB search
MAAAQGGTGTMAAWRVVAPGPVAGHPVELGRETVPEPGTGELLVKVLACGVCRTDLHVTE
GDLPVHRPRVIPGHEVVGEVAALGDSVSGSFAVGDRVGIAWLRHTCGHCAACLRGAENLC
RQSQYTGWDADGGYAEFATVPADYALHLPEGYSDAELAPLLCAGIIGYRALERATVPDGG
ALGVYGFGGSAHLTAQVASIRGARVHVMTRGAEARALAQRLGATSVQGVRDVPPEPLDSA
ILFAPVGDLVPVAMEALADGGTLAVAGIHLTDIPALEYQKHLFRERQIRSVTANTRSDSV
EFLRIAAEHRLSIDIHPYPLDRADRALRDLAGGKFSGAAVLEP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgcagggcggaaccggaacgatggccgcgtggcgcgtggtcgcgccgggc
cccgtcgcgggccacccggtggaactcggacgcgagacggttcccgagccgggaacgggc
gaacttctcgtgaaggtgctggcgtgcggagtgtgccgcaccgacctgcacgtgaccgaa
ggggacctgcccgtgcaccggccccgggtgattcccggccacgaggtggtgggggaggtt
gccgcactgggcgattcggtgtcggggtccttcgctgtcggcgaccgggtgggaatcgcc
tggctgcgtcacacctgcggacactgcgcggcctgcctgcgcggcgcggagaacctgtgc
aggcagtcgcagtacacgggatgggacgcggacggcggatacgccgaattcgcgacggtc
ccggccgactacgcgctgcacctgccggagggctactcggacgccgaactcgcacccctg
ctgtgcgccgggatcatcggctaccgggcactcgaacgtgccacggtccccgacggcggc
gcactgggcgtctacgggttcggcggcagcgcgcacctcaccgcccaggtcgcgtcgatc
cgcggcgcccgcgtgcacgtcatgacgcgtggggcggaggcccgtgcgctggcgcagcga
ctcggggcgacgtccgtgcagggtgtgcgcgacgtgccgccggaacccctcgactccgcg
attctgttcgcgccggtaggcgatctggtgcccgtggcgatggaggcgctcgccgacggc
ggcaccctcgcggtcgcggggatccacctcaccgacattcccgcgctcgagtatcagaag
catctgttccgggaacggcagatccgcagcgtcaccgccaatacccgttcggattccgtc
gaattcctgcgcatcgcagcggaacaccggctgagtatcgacatccacccgtacccactc
gaccgcgccgaccgggccctgcgcgacctggccggcggaaagttcagcggtgcagcagtt
ctcgagccgtag

DBGET integrated database retrieval system