KEGG   Rhodococcus jostii RHA1: RHA1_ro02246Help
Entry
RHA1_ro02246      CDS       T00382                                 

Definition
DNA-formamidopyrimidine glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rha  Rhodococcus jostii RHA1
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rha03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2378451..2379317)
Genome map
AA seq 288 aa AA seqDB search
MPELPEVEALAEFLREHAVGAVVGRVDVAALSVLKTFDPPITGLQGRDVTGAARFGKHLA
LDCSGLWLVTHLSRGGWLRWTDNPSAAPPKPGKGPLALRVHFFTPEGATPAFDLTEAGTK
KRLAVWVVHDPQEVEGIARLGPDALAVTEPEFAALLSTTSARIKNALVDQSLLAGVGNAY
SDEILHTAKISPFATSRTLPEDQVHVLYDAMRSVLSDAVQRSLGQDAARLKGEKRSGMRV
HARTGLPCPVCGDTIREVSFAEKSFQYCATCQTGGKVLADRRMSRLLK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctgcccgaggtggaggcgttagccgagttcctgcgtgaacatgccgtggga
gcggtcgtcggccgagtggacgtggcggccctgagcgtgctcaagacgttcgaccccccg
atcaccggcctgcagggccgcgacgtgacgggtgcggcccggttcggcaagcacctcgcg
ctcgactgttccgggttgtggctcgtcacccacctctcgcgtgggggctggttgcgctgg
accgacaacccgtcggcggcgccgccgaaaccggggaagggtccgctggcgctgcgggtg
cacttcttcaccccggagggcgcgacgccggcgttcgacctcaccgaggcaggcaccaag
aaacggctcgcggtgtgggtggtgcacgacccgcaggaggtggaggggattgcccggctc
ggacccgacgccctcgccgtcaccgaacccgagttcgccgcactgctgtccaccacgtcg
gcgcgtatcaagaatgcgctcgtcgaccagtcgctgctcgccggcgtcggtaacgcgtac
tccgatgaaatcctgcacaccgcaaagatttccccgttcgccacgtcgcgcaccctgccg
gaagaccaggtgcacgtgctgtacgacgcgatgcggtccgtgttgagcgacgccgtccag
aggtcgctcggccaggacgcggcgcggctgaagggggagaagcgatccgggatgcgggtg
cacgcccggaccggcctcccctgtcccgtctgcggcgacaccatccgggaagtgtcgttc
gcggagaagtcttttcagtactgcgcgacgtgtcagaccggaggcaaggtgctcgccgac
cgccggatgtcgcgactgctgaagtag

DBGET integrated database retrieval system