KEGG   Rhodococcus jostii: RHA1_ro02249Help
Entry
RHA1_ro02249      CDS       T00382                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
rha  Rhodococcus jostii
Pathway
rha00670  One carbon pool by folate
rha00790  Folate biosynthesis
rha01100  Metabolic pathways
Module
rha_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RHA1_ro02249
   00670 One carbon pool by folate
    RHA1_ro02249
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     RHA1_ro02249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ABG94056
UniProt: Q0SEI0
Position
2381001..2381507
Genome map
AA seq 168 aa AA seqDB search
MAARQVKLVWAQGVGGVIGLDNTIPWHVPEDMAYFKQVTQGHPVIMGRRTWDSLPPRFRP
LPGRRNIVISRQPDWTAEGAESADGLGSALALTDEDVCVIGGAQIYTAAMPFATQLLVSE
IDVTIDGDAWAPPIDDSWHAQDTGEWLTSAKNGTRYRWITYTRALPAR
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcgcggcaggtcaagctggtctgggcccagggcgtcggcggcgtcatcggcctc
gacaacacgatcccgtggcacgtccccgaggacatggcgtatttcaagcaggtgacgcag
ggtcacccggtgatcatgggccgcaggacgtgggactcgctgccgccgaggttccggccc
ctgcccgggcggcgcaacatcgtgatcagccgtcagcccgactggactgcggagggcgcc
gagtccgccgacgggctcggctccgcgctcgcgctcaccgacgaggacgtctgcgtcatc
ggcggcgcccagatctacacggcggcaatgccgttcgccacccaactgctggtctccgag
atcgacgtcacgatcgacggcgacgcctgggcacccccgatcgacgactcctggcacgcg
caggacaccggtgagtggctcacgtcggcgaagaacggcacccggtaccggtggatcacc
tacacgcgagcattacctgcgaggtaa

DBGET integrated database retrieval system