KEGG   Rhodococcus jostii RHA1: RHA1_ro02357Help
Entry
RHA1_ro02357      CDS       T00382                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rha  Rhodococcus jostii RHA1
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:rha00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2485580..2486419
Genome map
AA seq 279 aa AA seqDB search
MQHRESSFAGVGGIPIVYDVWLPERRPRGVLVLCHGFGEHARRYDHVIERLGELDLAIYA
PDHRGHGRSGGKRVHLKDWTEFTDDLHQLFGIASTDWPGTDRFLLGHSMGGSIALTYALD
HQQDLKALMLSGPAVDVTSGTPRIVVEIGKLVGRFLPGVPVESLDAKLVSRDPAVVSAYE
EDPLVHHGKVPAGIARGMILAAERLPERLPSLTIPLLLQHGQDDGLASVHGTELIAEYVG
SEDLTVEIYENLFHEVFNEPENEEVLDDLVEWLRPRVQA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatcgagaatcatccttcgccggcgtcggcggaattcccatcgtctacgacgtg
tggctccccgagcggcgcccgcgcggcgtgctggttctgtgccacggcttcggcgagcat
gcccggcggtacgaccatgtgatcgaacggctcggggaactcgacctcgcgatctacgcg
cccgaccaccgtgggcacgggcggtcgggcggcaaacgggtccatctgaaggactggacc
gagttcaccgacgacctgcaccagttgttcggcatcgcgtcgacggactggcccggcacc
gaccggtttctcctcgggcacagcatgggcggttccatcgcgctgacctacgcactcgac
caccagcaggacctgaaggcactcatgctgtccgggcctgcggtcgacgtgacgagcggc
acgccgcgcatcgtggtggagatcggcaagctggtgggtcgcttccttcccggagtgccc
gtcgagtcgctcgacgcgaagttggtctcccgcgatcctgcggtcgtgtcggcctacgag
gaggatcccctcgtccaccacgggaaggtgcctgccgggattgcgcgcgggatgatcctc
gccgccgaacggttgccggaacgtctgccgtcgctgacgattcccctgcttctccagcac
ggccaggacgacggactcgcgagtgtgcacggcacggaactgatcgcggagtacgtcggt
tcggaggatctcacggtggagatctacgaaaacctgttccacgaggtgttcaacgaaccg
gagaacgaggaggtactcgacgacctcgtcgagtggttgcggccgcgcgtgcaggcctga

DBGET integrated database retrieval system