KEGG   Rhodococcus jostii: RHA1_ro02357Help
Entry
RHA1_ro02357      CDS       T00382                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rha  Rhodococcus jostii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RHA1_ro02357
Enzymes [BR:rha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RHA1_ro02357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2485580..2486419
Genome map
AA seq 279 aa AA seqDB search
MQHRESSFAGVGGIPIVYDVWLPERRPRGVLVLCHGFGEHARRYDHVIERLGELDLAIYA
PDHRGHGRSGGKRVHLKDWTEFTDDLHQLFGIASTDWPGTDRFLLGHSMGGSIALTYALD
HQQDLKALMLSGPAVDVTSGTPRIVVEIGKLVGRFLPGVPVESLDAKLVSRDPAVVSAYE
EDPLVHHGKVPAGIARGMILAAERLPERLPSLTIPLLLQHGQDDGLASVHGTELIAEYVG
SEDLTVEIYENLFHEVFNEPENEEVLDDLVEWLRPRVQA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatcgagaatcatccttcgccggcgtcggcggaattcccatcgtctacgacgtg
tggctccccgagcggcgcccgcgcggcgtgctggttctgtgccacggcttcggcgagcat
gcccggcggtacgaccatgtgatcgaacggctcggggaactcgacctcgcgatctacgcg
cccgaccaccgtgggcacgggcggtcgggcggcaaacgggtccatctgaaggactggacc
gagttcaccgacgacctgcaccagttgttcggcatcgcgtcgacggactggcccggcacc
gaccggtttctcctcgggcacagcatgggcggttccatcgcgctgacctacgcactcgac
caccagcaggacctgaaggcactcatgctgtccgggcctgcggtcgacgtgacgagcggc
acgccgcgcatcgtggtggagatcggcaagctggtgggtcgcttccttcccggagtgccc
gtcgagtcgctcgacgcgaagttggtctcccgcgatcctgcggtcgtgtcggcctacgag
gaggatcccctcgtccaccacgggaaggtgcctgccgggattgcgcgcgggatgatcctc
gccgccgaacggttgccggaacgtctgccgtcgctgacgattcccctgcttctccagcac
ggccaggacgacggactcgcgagtgtgcacggcacggaactgatcgcggagtacgtcggt
tcggaggatctcacggtggagatctacgaaaacctgttccacgaggtgttcaacgaaccg
gagaacgaggaggtactcgacgacctcgtcgagtggttgcggccgcgcgtgcaggcctga

DBGET integrated database retrieval system