KEGG   Rhodococcus jostii: RHA1_ro02564Help
Entry
RHA1_ro02564      CDS       T00382                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
rha  Rhodococcus jostii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHA1_ro02564
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RHA1_ro02564
   00630 Glyoxylate and dicarboxylate metabolism
    RHA1_ro02564
Enzymes [BR:rha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RHA1_ro02564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2712577..2714796)
Genome map
AA seq 739 aa AA seqDB search
MEVCQVRKVSHFMTERVEVGGLQVAKVLYDFVNEEALPGTGVDADGFWSGAATVIDELAP
KNKALLSTRDDLQARIDGWHRDRAGTAIDPAEYKAFLTEIGYLVPEPAPFEVSTANVDTE
ITATAGPQLVVPVLNARFALNASNARWGSLYDALYGTNAIPDDGGAEAGATYNKVRGDRV
IAWARTFLDTAAPLAQGSHADAARYTVDGTALTVQLADGTVTGLAEPGKFVGYLGDPAAP
TSVLLRNHGLHAEIQIDPTSPIGSTDTAGVKDVVLESAVTTIMDFEDSVAAVDADDKVIG
YRNWLGLNRGDLTEEMTKGGTAFTRRLNPDRTYTAPDGSELTLHGRSLLFVRNVGHLMTT
PAILHGDGTEIPEGILDALITSLCAVHGLSTGEATGPLVNSRTGSIYIVKPKQHGPDEVA
FTTELFGRVEQVLGLPANTLKVGIMDEERRTTVNLAACINEARERVVFINTGFLDRTGDE
IHTSMEAGPMIRKAEMKKQTWITAYEDWNVDTGLACGLQGRAQIGKGMWAMTELMAEMLD
QKIGHPKAGANTAWVPSPTGATLHATHYHQVDVVAVQNQLKGTRRATLDEILTIPLAPST
DWSDAEKQEELDNNCQSILGYVVRWIDAGVGCSKVPDIHDVALMEDRATLRISSQLLANW
IRHGVVTADQVVQSLQRMAPIVDRQNQNDPTYRPLAPDFDTNIAFQAAKELILDGTTQPS
GYTEPILHRRRREYKAANA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtggaagtttgccaagtgcggaaggtgagtcatttcatgactgagcgtgttgaggtcggc
ggtctgcaggtcgcgaaggtgctctacgacttcgtgaacgaggaggcgctgcccgggacc
ggggtggacgccgacgggttctggtcgggtgcggccacggtgatcgacgagctggcgccg
aagaacaaggccctgctgtccacccgcgacgacctgcaggcccggatcgacggctggcac
cgcgaccgggccgggacggcgatcgacccggccgagtacaaggcgttcctgaccgagatc
gggtacctggtgcccgaaccggcccccttcgaggtgtccacggcgaacgtggacaccgag
atcaccgccaccgccggcccgcagctggtggtcccggtcctcaacgcccgcttcgcgctg
aacgcctccaacgcccggtgggggtcgctgtacgacgccctgtacggcaccaacgccatc
cccgacgacggcggcgcggaggcgggcgccacctacaacaaggtccgcggcgaccgggtc
atcgcctgggcccgcaccttcctcgacaccgccgcccccctcgcgcaggggtcgcacgcc
gacgccgcccgctacaccgtcgacggcaccgcgctgaccgtgcagctcgccgacggcacc
gtcaccgggctggcggagccgggtaagttcgtcggctacctcggcgacccggccgccccg
accagtgtgctgctgcgcaatcacgggttgcacgcggaaatccagatcgaccccacctcc
ccgatcgggtccaccgacaccgccggggtcaaggacgtggtgctcgagtccgcggtcacc
accatcatggacttcgaggactccgtcgccgccgtcgacgccgacgacaaggtgatcggc
taccgcaactggctgggcctcaaccgcggcgacctgaccgaggagatgaccaagggcggc
accgcgttcacccgccgcctcaacccggaccgcacctacaccgccccggacgggtccgag
ctcaccctgcacgggcggtcgctgctgttcgtccgcaacgtcgggcacctgatgaccacc
ccggcgatcctgcacggcgacggcaccgaaatccccgagggcatcctcgacgccctgatc
acctccctgtgcgccgtccacggactcagcacgggcgaggcgacggggccgttggtcaac
tcccgcaccgggtcgatctacatcgtcaaacccaagcagcacggccccgacgaggtcgcg
ttcaccaccgaactgttcggccgcgtcgagcaggtcctcgggctgcccgccaacaccctc
aaggtcggcatcatggacgaggaacgccgcaccaccgtcaacctcgccgcctgcatcaac
gaagcccgggagcgggtggtgttcatcaacaccgggttcctcgaccgcaccggcgacgag
atccacacctcgatggaggccgggccgatgatccgcaaggccgagatgaagaagcagacc
tggatcaccgcctacgaggactggaacgtcgacaccggactcgcctgcgggctgcagggg
cgggcgcagatcggcaagggcatgtgggcgatgaccgagctgatggccgagatgctcgac
cagaagatcggccaccccaaggccggcgcgaacaccgcatgggtgccgtccccgaccggg
gccaccctgcacgccacccactaccaccaggtcgacgtcgtcgccgtccaaaaccagctg
aagggcacccggcgggccaccctcgacgagatcctcaccatccccctcgcccccagcacc
gactggtccgacgccgagaaacaggaagaactcgacaacaactgccagtccatcctcggc
tacgtggtccgctggatcgacgccggcgtcggctgctccaaggtccccgacatccacgac
gtcgccctgatggaagaccgcgccaccctccgcatctcatcccagctgctggcgaactgg
atccggcacggcgtggtcaccgccgaccaggtcgtgcagtcactgcaacggatggccccg
atcgtggaccggcagaaccagaacgaccccacctaccggcccctggccccggacttcgac
accaacatcgccttccaggccgcgaaggaactcatcctcgacggcaccacccaaccctcc
ggctacaccgaaccgatcctgcaccgccgccgccgcgaatacaaagcagccaacgcctga

DBGET integrated database retrieval system