KEGG   Rhodococcus jostii: RHA1_ro02934Help
Entry
RHA1_ro02934      CDS       T00382                                 

Gene name
sdaA
Definition
L-serine ammonia-lyase (EC:4.3.1.17)
Orthology
K01752  
L-serine dehydratase [EC:4.3.1.17]
Organism
rha  Rhodococcus jostii
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHA1_ro02934 (sdaA)
   01230 Biosynthesis of amino acids
    RHA1_ro02934 (sdaA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHA1_ro02934 (sdaA)
   00270 Cysteine and methionine metabolism
    RHA1_ro02934 (sdaA)
Enzymes [BR:rha01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     RHA1_ro02934 (sdaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3100407..3101789
Genome map
AA seq 460 aa AA seqDB search
MTISVFDLFSVGIGPSSSHTVGPMRAAGTFVDDLDALGLLGDVAGVRVDLYGSLAATGAG
HGTMSAILLGLEGYRPDTIATEEMERRLDEVRASRRIRLGGTVDIPLAEDEMVLHPLTVL
DFHPNGMTLTATGVTGRQLHAQTYFSIGGGFVVTGAEPELPVDAGTNSLSFGSARELLDL
SEHYGLTISEIMLEHESALRPEPEVRARLLHIRDVMVECQRRGISRDGYLPGSLRVRRRA
RGWYERLNVEDPDRDPAFAEDWVNLVALAVNEENASGGRIVTAPTNGAAGIIPAVLHYAL
HYTPAGKADPDGTAVRFLLTAGAIGSLYKERASISGAEVGCQGEVGSAASMAAAGLAEIL
GGSPEQVENSAEIAMEHSLGLTCDPIGGLVQIPCIERNAISAGKAINAARMALRGDGTHR
VSLDQVIETMRATGADMSSKYKETSTGGLAVNVSVNLVEC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatcagtgtgttcgacctgttctcggtcggtatcggaccctcgagttcgcatacc
gtcgggccgatgcgggcggcgggcacgttcgtcgacgacctcgacgcactcggcctcctc
ggggacgtcgccggtgtccgtgtcgatctgtacggatcgctcgcggccaccggcgccggc
cacggcaccatgtcggcgatcctcctcggcctcgaggggtatcggcccgacaccatcgcc
acggaggagatggagaggcgactcgacgaggtgcgggcgagtcggcggatccgcctcggc
gggacggtcgacatcccgctcgccgaggacgagatggtgctgcacccgttgacggtcctg
gattttcaccccaacggcatgaccctcaccgccaccggcgtcaccggtcgccaactgcac
gcgcagacgtacttctcgatcggcggcggattcgtcgtcaccggcgccgaaccggaactg
cccgtcgacgcaggcacgaattcgctgtcgttcgggtcggcgcgcgaactgctcgacctc
agcgagcactacgggctcacgatcagtgagatcatgctcgagcacgaaagcgccctccgg
cccgagccggaggtccgggcgcggctcctgcacatccgggacgtgatggtcgagtgtcag
cgacgcggaatcagccgggacgggtacctgcccggcagtctgcgggtacgccgccgcgcc
cgcggctggtacgagcggctgaacgtcgaggatcccgatcgtgatcccgcgttcgccgag
gactgggtgaacctggtggccctcgccgtcaacgaggagaacgcgtccggcggacggatc
gtcaccgcccccaccaacggggcggccggcatcatcccggcggtcctgcactacgcgctg
cactacacccccgccggaaaggcggacccggacggcacggcggtgcgattcctgttgacg
gcaggcgcaatcggatccctgtacaaggaacgggcctcgatctccggggccgaggtgggc
tgccagggcgaggtgggttccgcggcgtccatggccgccgccggcctcgccgagatcctc
ggtggcagcccggagcaggtggagaattcggcggagatcgcgatggaacacagtctcggt
ctgacgtgtgatcccatcgggggcctggtgcagatcccgtgcatcgaacgcaacgccatc
tcggcgggcaaggcgatcaacgccgcccggatggctctgcgcggcgacggcacccaccgg
gtcagtttggatcaggtcatcgagacgatgcgggccaccggcgccgacatgagctcgaag
tacaaggagacctccaccggtggtctcgccgtgaacgtgtcggtgaacctcgtcgaatgc
tga

DBGET integrated database retrieval system