KEGG   Rhodococcus jostii: RHA1_ro02934Help
Entry
RHA1_ro02934      CDS       T00382                                 

Gene name
sdaA
Definition
(RefSeq) L-serine ammonia-lyase (EC:4.3.1.17)
  KO
K01752  
L-serine dehydratase [EC:4.3.1.17]
Organism
rha  Rhodococcus jostii
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHA1_ro02934 (sdaA)
   01230 Biosynthesis of amino acids
    RHA1_ro02934 (sdaA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHA1_ro02934 (sdaA)
   00270 Cysteine and methionine metabolism
    RHA1_ro02934 (sdaA)
Enzymes [BR:rha01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     RHA1_ro02934 (sdaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3100407..3101789
Genome map
AA seq 460 aa AA seqDB search
MTISVFDLFSVGIGPSSSHTVGPMRAAGTFVDDLDALGLLGDVAGVRVDLYGSLAATGAG
HGTMSAILLGLEGYRPDTIATEEMERRLDEVRASRRIRLGGTVDIPLAEDEMVLHPLTVL
DFHPNGMTLTATGVTGRQLHAQTYFSIGGGFVVTGAEPELPVDAGTNSLSFGSARELLDL
SEHYGLTISEIMLEHESALRPEPEVRARLLHIRDVMVECQRRGISRDGYLPGSLRVRRRA
RGWYERLNVEDPDRDPAFAEDWVNLVALAVNEENASGGRIVTAPTNGAAGIIPAVLHYAL
HYTPAGKADPDGTAVRFLLTAGAIGSLYKERASISGAEVGCQGEVGSAASMAAAGLAEIL
GGSPEQVENSAEIAMEHSLGLTCDPIGGLVQIPCIERNAISAGKAINAARMALRGDGTHR
VSLDQVIETMRATGADMSSKYKETSTGGLAVNVSVNLVEC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatcagtgtgttcgacctgttctcggtcggtatcggaccctcgagttcgcatacc
gtcgggccgatgcgggcggcgggcacgttcgtcgacgacctcgacgcactcggcctcctc
ggggacgtcgccggtgtccgtgtcgatctgtacggatcgctcgcggccaccggcgccggc
cacggcaccatgtcggcgatcctcctcggcctcgaggggtatcggcccgacaccatcgcc
acggaggagatggagaggcgactcgacgaggtgcgggcgagtcggcggatccgcctcggc
gggacggtcgacatcccgctcgccgaggacgagatggtgctgcacccgttgacggtcctg
gattttcaccccaacggcatgaccctcaccgccaccggcgtcaccggtcgccaactgcac
gcgcagacgtacttctcgatcggcggcggattcgtcgtcaccggcgccgaaccggaactg
cccgtcgacgcaggcacgaattcgctgtcgttcgggtcggcgcgcgaactgctcgacctc
agcgagcactacgggctcacgatcagtgagatcatgctcgagcacgaaagcgccctccgg
cccgagccggaggtccgggcgcggctcctgcacatccgggacgtgatggtcgagtgtcag
cgacgcggaatcagccgggacgggtacctgcccggcagtctgcgggtacgccgccgcgcc
cgcggctggtacgagcggctgaacgtcgaggatcccgatcgtgatcccgcgttcgccgag
gactgggtgaacctggtggccctcgccgtcaacgaggagaacgcgtccggcggacggatc
gtcaccgcccccaccaacggggcggccggcatcatcccggcggtcctgcactacgcgctg
cactacacccccgccggaaaggcggacccggacggcacggcggtgcgattcctgttgacg
gcaggcgcaatcggatccctgtacaaggaacgggcctcgatctccggggccgaggtgggc
tgccagggcgaggtgggttccgcggcgtccatggccgccgccggcctcgccgagatcctc
ggtggcagcccggagcaggtggagaattcggcggagatcgcgatggaacacagtctcggt
ctgacgtgtgatcccatcgggggcctggtgcagatcccgtgcatcgaacgcaacgccatc
tcggcgggcaaggcgatcaacgccgcccggatggctctgcgcggcgacggcacccaccgg
gtcagtttggatcaggtcatcgagacgatgcgggccaccggcgccgacatgagctcgaag
tacaaggagacctccaccggtggtctcgccgtgaacgtgtcggtgaacctcgtcgaatgc
tga

DBGET integrated database retrieval system