KEGG   Rhodococcus jostii: RHA1_ro03154Help
Entry
RHA1_ro03154      CDS       T00382                                 

Definition
(GenBank) probable undecaprenol kinase (EC:2.7.1.66)
  KO
K06153  
undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
rha  Rhodococcus jostii
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RHA1_ro03154
Enzymes [BR:rha01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     RHA1_ro03154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3338643..3339236)
Genome map
AA seq 197 aa AA seqDB search
MATIPVGILGLLLEHPLRTLFATPLAAAIFLTVNGLVLAAGEVLRRRSTRAVEPAVVGAH
AHAVSDEPPERALAALTSREAAGIGVIQSLALLAGISRSGVTMVGGLLRGLSHEDAAKFA
FLLATPVILAAGVLKLPTLAGPQGEGMHGQILVGALVAGVAAYLSVKFLTRYFTTRTLTP
FAVYCLVVGVLSIIRFA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtggccaccatcccggtcgggatcctgggcctgctcctcgaacacccgctgcgcaccctg
ttcgccacaccacttgctgccgccatctttctgacggtcaacggcctcgtcctcgcggcc
ggcgaggtcctgcgacggcggtcgaccagggcggtcgagccggccgtagtcggggcacac
gcacacgcggtgtcggacgaaccgcccgagcgggccctggccgccctgacctctcgggaa
gcggcgggcatcggggtgatccagagtctggccctcctcgccgggatcagccggtcgggc
gtgacgatggtcggcggcctgctccgcggcctgagccacgaggacgccgccaagttcgcc
ttcctgctggccaccccggtcatcctcgcggccggcgtcctcaaactgcccacccttgcc
ggcccgcagggcgaaggcatgcacgggcagatcctggtcggggcgctcgtcgcgggtgtc
gcggcgtatctgtcggtgaagttcctcacccgctacttcacaaccaggacgttgaccccg
ttcgccgtctactgcctggtcgtcggggtcctctcgatcatccgattcgcctga

DBGET integrated database retrieval system