KEGG   Rhodococcus jostii: RHA1_ro03154Help
Entry
RHA1_ro03154      CDS       T00382                                 

Definition
undecaprenol kinase (EC:2.7.1.66)
Orthology
K00887  
undecaprenol kinase [EC:2.7.1.66]
Organism
rha  Rhodococcus jostii
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RHA1_ro03154
Enzymes [BR:rha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.66  undecaprenol kinase
     RHA1_ro03154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3338643..3339236)
Genome map
AA seq 197 aa AA seqDB search
MATIPVGILGLLLEHPLRTLFATPLAAAIFLTVNGLVLAAGEVLRRRSTRAVEPAVVGAH
AHAVSDEPPERALAALTSREAAGIGVIQSLALLAGISRSGVTMVGGLLRGLSHEDAAKFA
FLLATPVILAAGVLKLPTLAGPQGEGMHGQILVGALVAGVAAYLSVKFLTRYFTTRTLTP
FAVYCLVVGVLSIIRFA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtggccaccatcccggtcgggatcctgggcctgctcctcgaacacccgctgcgcaccctg
ttcgccacaccacttgctgccgccatctttctgacggtcaacggcctcgtcctcgcggcc
ggcgaggtcctgcgacggcggtcgaccagggcggtcgagccggccgtagtcggggcacac
gcacacgcggtgtcggacgaaccgcccgagcgggccctggccgccctgacctctcgggaa
gcggcgggcatcggggtgatccagagtctggccctcctcgccgggatcagccggtcgggc
gtgacgatggtcggcggcctgctccgcggcctgagccacgaggacgccgccaagttcgcc
ttcctgctggccaccccggtcatcctcgcggccggcgtcctcaaactgcccacccttgcc
ggcccgcagggcgaaggcatgcacgggcagatcctggtcggggcgctcgtcgcgggtgtc
gcggcgtatctgtcggtgaagttcctcacccgctacttcacaaccaggacgttgaccccg
ttcgccgtctactgcctggtcgtcggggtcctctcgatcatccgattcgcctga

DBGET integrated database retrieval system