KEGG   Rhodococcus jostii: RHA1_ro03319Help
Entry
RHA1_ro03319      CDS       T00382                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase, E2 component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rha  Rhodococcus jostii
Pathway
rha00010  Glycolysis / Gluconeogenesis
rha00020  Citrate cycle (TCA cycle)
rha00620  Pyruvate metabolism
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
Module
rha_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHA1_ro03319 (pdhC)
   00020 Citrate cycle (TCA cycle)
    RHA1_ro03319 (pdhC)
   00620 Pyruvate metabolism
    RHA1_ro03319 (pdhC)
Enzymes [BR:rha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RHA1_ro03319 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ABG95122
UniProt: Q0SBG4
Position
complement(3514771..3516003)
Genome map
AA seq 410 aa AA seqDB search
MSNQVFLLPDLGEGLTEADIAEWKVRVGDTVTIDQVVVEVETAKAAVEVPIPFEGTVISL
HGDEGSTLQVGTPLITVSGTPAAHEQYREEEQAGSGNVLIGYGTSEDTRRRRRRVGVTRE
ATRPEPNRTGVAPRVISPVVRNLARQNGLDLSRLSGSGPGGVINRADVEKALATTPAPAD
AQRIPIKGLRKAVADKLSTSRREIPDATTWVDVDASELLVARRAINATLDADAGVSLMAL
LARLALAALKQYPELNSTVDTERGEIVRYGHVHLGIAAQTPRGLVVPVIERADSLTTVEL
ARQLRDTTALAREGTLPPARLTGGTFTLNNYGVFGVDGSTPIINHPEAAILGVGRIIDKP
WVIDGQLAVRKVTQVSLSFDHRVCDGGVAGGFLRLFADYIENPITALGRL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccaggtcttcctgctccccgacctcggcgaaggactcaccgaggccgacatc
gccgaatggaaagtccgggtcggcgacaccgtcaccatcgaccaggtggtcgtcgaggtc
gaaaccgcgaaagccgcggtcgaggtgccgattcccttcgagggcacggtgatctccctg
cacggcgacgaaggctcgacgctgcaggtgggcaccccgctgatcaccgtcagcggaacc
cccgccgcgcacgagcagtaccgcgaagaagaacaagcaggctcgggcaacgtcctgatc
gggtacggcaccagcgaggacacccgccggcgtcggcgacgcgtcggcgtgacacgtgag
gccacacggccggaaccgaaccgcaccggtgttgcgccacgggtcatctcgccggtcgtc
cgcaacctcgcgcggcagaacggcctcgacctgtcgcggctgtcggggagcggtcccggc
ggtgtgatcaaccgtgccgacgtcgagaaggcactcgccaccacacccgcgccagccgac
gcgcagcggattccgatcaagggcctgcggaaagcggtcgccgacaagctgtcgactagt
cgacgcgaaatcccggacgcgacaacctgggtcgacgtggacgccagtgaactcctcgtc
gcccgccgggcaatcaacgccaccctcgacgccgacgccggcgtgagcctgatggccctg
ctcgcgcgcctggccctcgcggcgctgaagcagtacccggaactgaactcgaccgtcgac
accgaacggggcgagatcgtccgatacggtcacgtccacctcggcatcgcggcgcagact
ccgcgcggcctggtcgtcccggtgatcgaaagggccgactcgctcaccaccgtcgaactg
gcccggcaactgcgggacaccacggcgttggcccgtgaggggacgctcccgccggcacgg
ctgaccggtggcacgttcaccctcaacaactacggcgtcttcggcgtggacggctcgacc
ccgatcatcaaccatcccgaggccgcgatcctcggcgtcggccgcatcatcgacaaaccg
tgggtcatagacgggcagttggccgttcggaaggtgacccaggtgtcgctgagcttcgat
caccgcgtgtgtgacggcggtgtcgcgggcgggttcctcagattgttcgccgattacatc
gagaacccgatcaccgcgctggggaggctctga

DBGET integrated database retrieval system