KEGG   Rhodococcus jostii: RHA1_ro03527Help
Entry
RHA1_ro03527      CDS       T00382                                 

Definition
guanidinobutyrase (EC:3.5.3.7)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rha  Rhodococcus jostii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RHA1_ro03527
Enzymes [BR:rha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     RHA1_ro03527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3729906..3730943)
Genome map
AA seq 345 aa AA seqDB search
MSTDDIQGPIDATRIQGPVDATRTPRYAEPSTFARLPRLDEVSRADVTVMGVPFDSGVSY
RPGARFGPGHIRAASKLLRPYNPALDVHPFAAQQVADFGDIGVNPFDIQEALATVDGAVT
DLRKDGSTVLTLGGDHTIALPILRSLARDHGPIAVLHFDAHLDTWDTYFGAPYTHGTPFR
RASEEGLIDLERSQHIGIRGPLYSKKDLEDDAVLGFQVIRSDDYEVDGVASIVERMRRRL
DGGPVYVSVDIDVLDPAHAPGTGTPEAGGMTSRELLNTLRGLVGLNVVGADIVEVAPAYD
HAEITGIAAAHVAYELLSVLAINASSAPGRAARGETLRQAAYVTK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagacgacatccagggccccatcgacgcgacccgcatccaaggccccgtcgac
gccacccgcacgccgcgctacgccgaacccagcacattcgcccgcctcccccggctcgac
gaggtgtctcgcgccgacgtcaccgtgatgggcgtcccgttcgactccggcgtgagctac
cgtcccggcgcacgcttcggccccggccacatccgcgccgcatcgaagctgctgcgtccg
tacaaccccgcactcgacgtgcaccccttcgcggcgcagcaggtcgccgacttcggcgac
atcggcgtcaacccgttcgacatccaggaagccctggccaccgtcgacggcgccgtcacc
gacctgcgcaaggacggttccaccgtgctgacgctcggcggcgaccacaccatcgccctg
ccgatcctgcggtccctcgcccgcgaccacggccccatcgccgtgctgcacttcgacgcg
cacctcgacacttgggacacctacttcggtgccccctacacgcacggcaccccgttccgg
cgggccagcgaggaggggctgatcgacctcgagcgttcgcagcacatcggtatccgcggc
ccgctgtacagcaagaaggacctcgaggacgacgccgttctcggcttccaggtcatccgc
tccgacgactacgaggtggacggggtcgcgagcatcgtcgaacggatgcgtcgacggctc
gacggcggaccggtctacgtgtccgtggacatcgacgtcctcgatcccgcgcacgcgccg
ggcaccggaacacccgaggccggtgggatgacgtcccgcgagttgctgaacacactgcgc
ggactggtcggcctgaacgtggtcggcgccgacatcgtggaggtggcgcccgcatacgac
cacgccgagatcaccggcatcgcggcagcgcatgtcgcgtacgagttgctgtcggtgctc
gcgatcaacgcgtcgtcggccccgggacgcgctgcgcgcggcgagacgctccggcaggcg
gcgtacgtgacgaagtga

DBGET integrated database retrieval system