KEGG   Rhodococcus jostii: RHA1_ro03742Help
Entry
RHA1_ro03742      CDS       T00382                                 

Definition
acetyl/propionyl-CoA carboxylase subunit alpha (EC:6.4.1.-)
Orthology
K11263  
acetyl-/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Organism
rha  Rhodococcus jostii
Pathway
Fatty acid biosynthesis
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RHA1_ro03742
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RHA1_ro03742
   00640 Propanoate metabolism
    RHA1_ro03742
  Lipid metabolism
   00061 Fatty acid biosynthesis
    RHA1_ro03742
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHA1_ro03742
  Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    RHA1_ro03742
Enzymes [BR:rha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     RHA1_ro03742
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     RHA1_ro03742
    6.4.1.3  propionyl-CoA carboxylase
     RHA1_ro03742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3947944..3949725)
Genome map
AA seq 593 aa AA seqDB search
MSSARISKVLVANRGEIAVRVIRAAADAGLASVAVYAEPDADAPFVRLADEAFALGGQTS
AESYLVFDKILDAAAKSGADAIHPGYGFLSENADFAQAVIDAGLIWIGPSPQSIRDLGDK
VTARHIAEKAKAPMAAGTKDPVKNADEVIAFAQEYGVPVAIKAAFGGGGRGMKVAHTIEE
IPELFDSATREAVAAFGRGECFVEQYLDKARHVEAQVIADQHGNVIVAGTRDCSLQRRFQ
KLVEEAPAPFLTDDQRHRIHTSAKAICKEAGYYGAGTVEYLVQGDTVSFLEVNTRLQVEH
PVTEETAGIDLVLQQFKIANGERLDLTEDPTPRGHAFEFRINGEDAGRGFLPAPGPVTKF
VPPTGPGVRMDSGVETGSVIGGQFDSMLAKLIVTGATRDEALARARRALAEFQVEGLATV
IPFHRAVVSDPAFIGDGTSFDVYTKWIETEWDNQIEPFTGTQPIDEDDTLPRQNVVVEVG
GRRVEVSLPGQFTLGTGGGAAPGAVRKKPKARTRGGAHGGAASGDAVTAPMQGTVVKVAV
EEGQQVAEGDLIAVLEAMKMENPVNAHKAGVVTGLAVEPGAAITQGTVLAELK
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgcacgtatttccaaggtgctcgtcgcgaaccgcggtgagattgcagtgcgg
gtgatccgggccgccgccgatgccggcctggccagcgtcgccgtctacgccgaacccgac
gccgacgccccgttcgtgcgcctggccgacgaagcattcgccctcggcgggcagacctcc
gccgagtcctacctggtgttcgacaaaatcttggacgctgccgccaagtccggcgccgac
gccatccaccccggctacggtttcctctccgagaacgccgacttcgcgcaggccgtgatc
gacgccggcctgatctggatcggcccctccccgcaatcgatccgcgacctcggcgacaag
gtcaccgcccggcacatcgccgaaaaagccaaggccccgatggccgccggcaccaaggac
cccgtcaagaacgccgacgaggtcatcgccttcgcccaggaatacggggtccccgtcgcc
atcaaggccgcgttcggcggcggcggccgcggcatgaaggtcgcccacaccatcgaggaa
atccccgaactgttcgactccgccacccgcgaggccgtcgccgcgttcggccgcggcgaa
tgcttcgtcgaacagtatctggacaaggcccgccacgtcgaagcccaggtcatcgccgac
cagcacggcaacgtcatcgtcgccggcacccgcgactgctccctgcaacgccgcttccag
aaactcgtcgaggaggcccccgccccgttcctcaccgacgaccaacgccaccgcatccac
acctccgccaaggccatctgcaaagaggccggctactacggcgccggcaccgtcgaatac
ctcgtccagggcgacaccgtctccttcctcgaggtcaacacccgcctgcaggtcgaacac
cccgtcaccgaggaaaccgccggcatcgacctggtcctgcaacagttcaagatcgccaac
ggtgaacgcctcgacctcaccgaggaccccaccccccgcggccacgccttcgaattccgc
atcaacggcgaggacgccggccgcggcttcctgcccgcccccggcccggtcaccaagttc
gtgccccccaccggccccggcgtccggatggactccggcgtcgaaaccggctcggtgatc
ggcggccagttcgactccatgctcgccaaactcatcgtcaccggcgccacccgcgacgag
gccctggcccgcgcccgccgcgccctcgccgaattccaggtcgaaggcctggccaccgtc
atcccgttccaccgggccgtcgtctccgaccccgccttcatcggcgacggcacctccttc
gacgtctacaccaagtggatcgaaaccgaatgggacaaccagatcgaaccgttcaccggc
acccagccgatcgacgaggacgacaccctgccccggcagaacgtcgtcgtcgaggtcggc
ggccgccgcgtcgaggtgtccctgcccggccagttcaccctcggcaccggcggcggtgcc
gcacccggggcggtccgcaagaagcccaaggcccgcacccgcggcggcgcccacggcggc
gccgcctccggtgacgccgtcaccgccccgatgcagggcaccgtcgtcaaggtcgccgtc
gaagaaggccaacaagtcgccgagggcgacctcatcgccgtcctcgaggccatgaagatg
gaaaaccccgtcaacgcccacaaggccggcgtcgtcaccggcctcgccgtcgaacccggc
gccgccatcacccagggcaccgtcctcgccgaactgaaatag

DBGET integrated database retrieval system