KEGG   Rhodococcus jostii RHA1: RHA1_ro03742Help
Entry
RHA1_ro03742      CDS       T00382                                 

Definition
acetyl/propionyl-CoA carboxylase subunit alpha (EC:6.4.1.-)
Orthology
K11263  
acetyl-/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.3.4.14]
Organism
rha  Rhodococcus jostii RHA1
Pathway
Fatty acid biosynthesis
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rha01212]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:rha00061]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3947944..3949725)
Genome map
AA seq 593 aa AA seqDB search
MSSARISKVLVANRGEIAVRVIRAAADAGLASVAVYAEPDADAPFVRLADEAFALGGQTS
AESYLVFDKILDAAAKSGADAIHPGYGFLSENADFAQAVIDAGLIWIGPSPQSIRDLGDK
VTARHIAEKAKAPMAAGTKDPVKNADEVIAFAQEYGVPVAIKAAFGGGGRGMKVAHTIEE
IPELFDSATREAVAAFGRGECFVEQYLDKARHVEAQVIADQHGNVIVAGTRDCSLQRRFQ
KLVEEAPAPFLTDDQRHRIHTSAKAICKEAGYYGAGTVEYLVQGDTVSFLEVNTRLQVEH
PVTEETAGIDLVLQQFKIANGERLDLTEDPTPRGHAFEFRINGEDAGRGFLPAPGPVTKF
VPPTGPGVRMDSGVETGSVIGGQFDSMLAKLIVTGATRDEALARARRALAEFQVEGLATV
IPFHRAVVSDPAFIGDGTSFDVYTKWIETEWDNQIEPFTGTQPIDEDDTLPRQNVVVEVG
GRRVEVSLPGQFTLGTGGGAAPGAVRKKPKARTRGGAHGGAASGDAVTAPMQGTVVKVAV
EEGQQVAEGDLIAVLEAMKMENPVNAHKAGVVTGLAVEPGAAITQGTVLAELK
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgcacgtatttccaaggtgctcgtcgcgaaccgcggtgagattgcagtgcgg
gtgatccgggccgccgccgatgccggcctggccagcgtcgccgtctacgccgaacccgac
gccgacgccccgttcgtgcgcctggccgacgaagcattcgccctcggcgggcagacctcc
gccgagtcctacctggtgttcgacaaaatcttggacgctgccgccaagtccggcgccgac
gccatccaccccggctacggtttcctctccgagaacgccgacttcgcgcaggccgtgatc
gacgccggcctgatctggatcggcccctccccgcaatcgatccgcgacctcggcgacaag
gtcaccgcccggcacatcgccgaaaaagccaaggccccgatggccgccggcaccaaggac
cccgtcaagaacgccgacgaggtcatcgccttcgcccaggaatacggggtccccgtcgcc
atcaaggccgcgttcggcggcggcggccgcggcatgaaggtcgcccacaccatcgaggaa
atccccgaactgttcgactccgccacccgcgaggccgtcgccgcgttcggccgcggcgaa
tgcttcgtcgaacagtatctggacaaggcccgccacgtcgaagcccaggtcatcgccgac
cagcacggcaacgtcatcgtcgccggcacccgcgactgctccctgcaacgccgcttccag
aaactcgtcgaggaggcccccgccccgttcctcaccgacgaccaacgccaccgcatccac
acctccgccaaggccatctgcaaagaggccggctactacggcgccggcaccgtcgaatac
ctcgtccagggcgacaccgtctccttcctcgaggtcaacacccgcctgcaggtcgaacac
cccgtcaccgaggaaaccgccggcatcgacctggtcctgcaacagttcaagatcgccaac
ggtgaacgcctcgacctcaccgaggaccccaccccccgcggccacgccttcgaattccgc
atcaacggcgaggacgccggccgcggcttcctgcccgcccccggcccggtcaccaagttc
gtgccccccaccggccccggcgtccggatggactccggcgtcgaaaccggctcggtgatc
ggcggccagttcgactccatgctcgccaaactcatcgtcaccggcgccacccgcgacgag
gccctggcccgcgcccgccgcgccctcgccgaattccaggtcgaaggcctggccaccgtc
atcccgttccaccgggccgtcgtctccgaccccgccttcatcggcgacggcacctccttc
gacgtctacaccaagtggatcgaaaccgaatgggacaaccagatcgaaccgttcaccggc
acccagccgatcgacgaggacgacaccctgccccggcagaacgtcgtcgtcgaggtcggc
ggccgccgcgtcgaggtgtccctgcccggccagttcaccctcggcaccggcggcggtgcc
gcacccggggcggtccgcaagaagcccaaggcccgcacccgcggcggcgcccacggcggc
gccgcctccggtgacgccgtcaccgccccgatgcagggcaccgtcgtcaaggtcgccgtc
gaagaaggccaacaagtcgccgagggcgacctcatcgccgtcctcgaggccatgaagatg
gaaaaccccgtcaacgcccacaaggccggcgtcgtcaccggcctcgccgtcgaacccggc
gccgccatcacccagggcaccgtcctcgccgaactgaaatag

DBGET integrated database retrieval system