KEGG   Rhodococcus jostii: RHA1_ro03742Help
Entry
RHA1_ro03742      CDS       T00382                                 

Definition
(GenBank) acetyl/propionyl-CoA carboxylase alpha subunit
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Organism
rha  Rhodococcus jostii
Pathway
rha00061  Fatty acid biosynthesis
rha00280  Valine, leucine and isoleucine degradation
rha00620  Pyruvate metabolism
rha00630  Glyoxylate and dicarboxylate metabolism
rha00640  Propanoate metabolism
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
rha01212  Fatty acid metabolism
Module
rha_M00082  Fatty acid biosynthesis, initiation
rha_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RHA1_ro03742
   00630 Glyoxylate and dicarboxylate metabolism
    RHA1_ro03742
   00640 Propanoate metabolism
    RHA1_ro03742
  Lipid metabolism
   00061 Fatty acid biosynthesis
    RHA1_ro03742
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHA1_ro03742
Enzymes [BR:rha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     RHA1_ro03742
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     RHA1_ro03742
    6.4.1.3  propionyl-CoA carboxylase
     RHA1_ro03742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Biotin_lipoyl_2 ATP-grasp ATPgrasp_Ter HlyD_3 Dala_Dala_lig_C HlyD_D23 ATP-grasp_3 DUF2118 RnfC_N ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ABG95542
UniProt: Q0SA94
Position
complement(3947944..3949725)
Genome map
AA seq 593 aa AA seqDB search
MSSARISKVLVANRGEIAVRVIRAAADAGLASVAVYAEPDADAPFVRLADEAFALGGQTS
AESYLVFDKILDAAAKSGADAIHPGYGFLSENADFAQAVIDAGLIWIGPSPQSIRDLGDK
VTARHIAEKAKAPMAAGTKDPVKNADEVIAFAQEYGVPVAIKAAFGGGGRGMKVAHTIEE
IPELFDSATREAVAAFGRGECFVEQYLDKARHVEAQVIADQHGNVIVAGTRDCSLQRRFQ
KLVEEAPAPFLTDDQRHRIHTSAKAICKEAGYYGAGTVEYLVQGDTVSFLEVNTRLQVEH
PVTEETAGIDLVLQQFKIANGERLDLTEDPTPRGHAFEFRINGEDAGRGFLPAPGPVTKF
VPPTGPGVRMDSGVETGSVIGGQFDSMLAKLIVTGATRDEALARARRALAEFQVEGLATV
IPFHRAVVSDPAFIGDGTSFDVYTKWIETEWDNQIEPFTGTQPIDEDDTLPRQNVVVEVG
GRRVEVSLPGQFTLGTGGGAAPGAVRKKPKARTRGGAHGGAASGDAVTAPMQGTVVKVAV
EEGQQVAEGDLIAVLEAMKMENPVNAHKAGVVTGLAVEPGAAITQGTVLAELK
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgcacgtatttccaaggtgctcgtcgcgaaccgcggtgagattgcagtgcgg
gtgatccgggccgccgccgatgccggcctggccagcgtcgccgtctacgccgaacccgac
gccgacgccccgttcgtgcgcctggccgacgaagcattcgccctcggcgggcagacctcc
gccgagtcctacctggtgttcgacaaaatcttggacgctgccgccaagtccggcgccgac
gccatccaccccggctacggtttcctctccgagaacgccgacttcgcgcaggccgtgatc
gacgccggcctgatctggatcggcccctccccgcaatcgatccgcgacctcggcgacaag
gtcaccgcccggcacatcgccgaaaaagccaaggccccgatggccgccggcaccaaggac
cccgtcaagaacgccgacgaggtcatcgccttcgcccaggaatacggggtccccgtcgcc
atcaaggccgcgttcggcggcggcggccgcggcatgaaggtcgcccacaccatcgaggaa
atccccgaactgttcgactccgccacccgcgaggccgtcgccgcgttcggccgcggcgaa
tgcttcgtcgaacagtatctggacaaggcccgccacgtcgaagcccaggtcatcgccgac
cagcacggcaacgtcatcgtcgccggcacccgcgactgctccctgcaacgccgcttccag
aaactcgtcgaggaggcccccgccccgttcctcaccgacgaccaacgccaccgcatccac
acctccgccaaggccatctgcaaagaggccggctactacggcgccggcaccgtcgaatac
ctcgtccagggcgacaccgtctccttcctcgaggtcaacacccgcctgcaggtcgaacac
cccgtcaccgaggaaaccgccggcatcgacctggtcctgcaacagttcaagatcgccaac
ggtgaacgcctcgacctcaccgaggaccccaccccccgcggccacgccttcgaattccgc
atcaacggcgaggacgccggccgcggcttcctgcccgcccccggcccggtcaccaagttc
gtgccccccaccggccccggcgtccggatggactccggcgtcgaaaccggctcggtgatc
ggcggccagttcgactccatgctcgccaaactcatcgtcaccggcgccacccgcgacgag
gccctggcccgcgcccgccgcgccctcgccgaattccaggtcgaaggcctggccaccgtc
atcccgttccaccgggccgtcgtctccgaccccgccttcatcggcgacggcacctccttc
gacgtctacaccaagtggatcgaaaccgaatgggacaaccagatcgaaccgttcaccggc
acccagccgatcgacgaggacgacaccctgccccggcagaacgtcgtcgtcgaggtcggc
ggccgccgcgtcgaggtgtccctgcccggccagttcaccctcggcaccggcggcggtgcc
gcacccggggcggtccgcaagaagcccaaggcccgcacccgcggcggcgcccacggcggc
gccgcctccggtgacgccgtcaccgccccgatgcagggcaccgtcgtcaaggtcgccgtc
gaagaaggccaacaagtcgccgagggcgacctcatcgccgtcctcgaggccatgaagatg
gaaaaccccgtcaacgcccacaaggccggcgtcgtcaccggcctcgccgtcgaacccggc
gccgccatcacccagggcaccgtcctcgccgaactgaaatag

DBGET integrated database retrieval system