KEGG   Rhodococcus jostii: RHA1_ro03742Help
Entry
RHA1_ro03742      CDS       T00382                                 

Definition
acetyl/propionyl-CoA carboxylase subunit alpha (EC:6.4.1.-)
Orthology
K11263  
acetyl-/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Organism
rha  Rhodococcus jostii
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RHA1_ro03742
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RHA1_ro03742
   00640 Propanoate metabolism
    RHA1_ro03742
  Lipid metabolism
   00061 Fatty acid biosynthesis
    RHA1_ro03742
  Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    RHA1_ro03742
Enzymes [BR:rha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     RHA1_ro03742
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     RHA1_ro03742
    6.4.1.3  propionyl-CoA carboxylase
     RHA1_ro03742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3947944..3949725)
Genome map
AA seq 593 aa AA seqDB search
MSSARISKVLVANRGEIAVRVIRAAADAGLASVAVYAEPDADAPFVRLADEAFALGGQTS
AESYLVFDKILDAAAKSGADAIHPGYGFLSENADFAQAVIDAGLIWIGPSPQSIRDLGDK
VTARHIAEKAKAPMAAGTKDPVKNADEVIAFAQEYGVPVAIKAAFGGGGRGMKVAHTIEE
IPELFDSATREAVAAFGRGECFVEQYLDKARHVEAQVIADQHGNVIVAGTRDCSLQRRFQ
KLVEEAPAPFLTDDQRHRIHTSAKAICKEAGYYGAGTVEYLVQGDTVSFLEVNTRLQVEH
PVTEETAGIDLVLQQFKIANGERLDLTEDPTPRGHAFEFRINGEDAGRGFLPAPGPVTKF
VPPTGPGVRMDSGVETGSVIGGQFDSMLAKLIVTGATRDEALARARRALAEFQVEGLATV
IPFHRAVVSDPAFIGDGTSFDVYTKWIETEWDNQIEPFTGTQPIDEDDTLPRQNVVVEVG
GRRVEVSLPGQFTLGTGGGAAPGAVRKKPKARTRGGAHGGAASGDAVTAPMQGTVVKVAV
EEGQQVAEGDLIAVLEAMKMENPVNAHKAGVVTGLAVEPGAAITQGTVLAELK
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgcacgtatttccaaggtgctcgtcgcgaaccgcggtgagattgcagtgcgg
gtgatccgggccgccgccgatgccggcctggccagcgtcgccgtctacgccgaacccgac
gccgacgccccgttcgtgcgcctggccgacgaagcattcgccctcggcgggcagacctcc
gccgagtcctacctggtgttcgacaaaatcttggacgctgccgccaagtccggcgccgac
gccatccaccccggctacggtttcctctccgagaacgccgacttcgcgcaggccgtgatc
gacgccggcctgatctggatcggcccctccccgcaatcgatccgcgacctcggcgacaag
gtcaccgcccggcacatcgccgaaaaagccaaggccccgatggccgccggcaccaaggac
cccgtcaagaacgccgacgaggtcatcgccttcgcccaggaatacggggtccccgtcgcc
atcaaggccgcgttcggcggcggcggccgcggcatgaaggtcgcccacaccatcgaggaa
atccccgaactgttcgactccgccacccgcgaggccgtcgccgcgttcggccgcggcgaa
tgcttcgtcgaacagtatctggacaaggcccgccacgtcgaagcccaggtcatcgccgac
cagcacggcaacgtcatcgtcgccggcacccgcgactgctccctgcaacgccgcttccag
aaactcgtcgaggaggcccccgccccgttcctcaccgacgaccaacgccaccgcatccac
acctccgccaaggccatctgcaaagaggccggctactacggcgccggcaccgtcgaatac
ctcgtccagggcgacaccgtctccttcctcgaggtcaacacccgcctgcaggtcgaacac
cccgtcaccgaggaaaccgccggcatcgacctggtcctgcaacagttcaagatcgccaac
ggtgaacgcctcgacctcaccgaggaccccaccccccgcggccacgccttcgaattccgc
atcaacggcgaggacgccggccgcggcttcctgcccgcccccggcccggtcaccaagttc
gtgccccccaccggccccggcgtccggatggactccggcgtcgaaaccggctcggtgatc
ggcggccagttcgactccatgctcgccaaactcatcgtcaccggcgccacccgcgacgag
gccctggcccgcgcccgccgcgccctcgccgaattccaggtcgaaggcctggccaccgtc
atcccgttccaccgggccgtcgtctccgaccccgccttcatcggcgacggcacctccttc
gacgtctacaccaagtggatcgaaaccgaatgggacaaccagatcgaaccgttcaccggc
acccagccgatcgacgaggacgacaccctgccccggcagaacgtcgtcgtcgaggtcggc
ggccgccgcgtcgaggtgtccctgcccggccagttcaccctcggcaccggcggcggtgcc
gcacccggggcggtccgcaagaagcccaaggcccgcacccgcggcggcgcccacggcggc
gccgcctccggtgacgccgtcaccgccccgatgcagggcaccgtcgtcaaggtcgccgtc
gaagaaggccaacaagtcgccgagggcgacctcatcgccgtcctcgaggccatgaagatg
gaaaaccccgtcaacgcccacaaggccggcgtcgtcaccggcctcgccgtcgaacccggc
gccgccatcacccagggcaccgtcctcgccgaactgaaatag

DBGET integrated database retrieval system