KEGG   Rhodococcus jostii RHA1: RHA1_ro04090Help
Entry
RHA1_ro04090      CDS       T00382                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
rha  Rhodococcus jostii RHA1
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:rha00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rha00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4305445..4306626
Genome map
AA seq 393 aa AA seqDB search
MTATDTRRAAGDISALADFGIEVPSWAYGNSGTRFKVFATAGVPRDPYEKIEDAAQVHRV
TGAAPRVSLHIPWDRVDDFGKLAAFAADQGVSLGAINSNVFQDDDYKLGSLTNADPKIRA
KAVAHHVECIDVMRATGSKDLKLWLPDGTNYAGQDSIRARQDRLADSLQKIYAELDDDHR
LLIEYKFFEPYFYTTDIPDWGTSLLHCLALGEKAQVVLDTGHHAPGTNIEFIVAQLIRQG
RLGAFDFNSRFYADDDLIVGSADPFQLFRIMHEIVRAGAHLPDSGVNFMLDQCHNIEPKI
PGQIRSIMNVQEATAKALLVDGDALEAAQQSGDVLGAHAVLMDGYNTDVRPLLAELRESQ
GREADPIGAFARSGYLERIERERVGGNQASWGA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaactgacactcggcgcgcggccggcgacatctccgcccttgccgacttcgga
atcgaagtgcccagttgggcatacgggaattccggcacccgattcaaggtgttcgccacc
gccggcgtcccgcgcgatccgtacgagaagatcgaggacgccgcacaggtgcaccgggtg
accggggcggcgccgcgggtgtcgctgcacatcccgtgggaccgtgtcgacgacttcggc
aagctcgccgcgttcgccgccgatcagggggtgtcgctgggggcgatcaactccaacgtc
ttccaggacgacgactacaagctggggtcgctgaccaacgccgacccgaagatccgcgcg
aaggccgtcgcccaccacgtcgagtgcatcgacgtcatgcgggcgacgggctcgaaggat
ttgaagctgtggctgcccgacggcaccaactacgccggccaggattcgatccgcgcccgg
caggatcggctcgccgattcgctgcagaagatctacgccgaactcgacgacgatcaccgc
ctgctgatcgagtacaagttcttcgagccgtacttctacaccaccgacattcccgactgg
ggaacgtcgctgctgcactgcctggcgctgggcgagaaggcgcaggtggtcctggacacc
ggtcatcacgcgccgggcacgaacatcgaattcatcgtcgcccagctgatccggcaggga
cggctcggcgccttcgatttcaactcccgcttctacgccgacgacgacctgatcgtcgga
tccgcggacccgttccagctgttccggatcatgcacgagatcgtccgggcgggagcgcac
ctcccggattccggggtgaacttcatgctcgaccagtgccacaacatcgagccgaagatt
cccggccagatccggtcgatcatgaacgtccaggaagccacggccaaggcactgctcgtc
gacggcgacgcactcgaggcggcccagcagtcgggtgacgtgctcggcgcccacgcggta
ttgatggacgggtacaacaccgacgtccggccgctgctggcggaactgcgcgaatcgcag
ggcagggaagccgacccgatcggcgcattcgcgcgctccggatacctggagcggatcgag
cgcgagcgggtcggcggaaaccaggcgagctggggcgcgtga

DBGET integrated database retrieval system