KEGG   Rhodococcus jostii: RHA1_ro04205Help
Entry
RHA1_ro04205      CDS       T00382                                 

Gene name
fadB1
Definition
fatty oxidation complex subunit alpha (EC:4.2.1.17 5.1.2.3 5.3.3.8)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rha  Rhodococcus jostii
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHA1_ro04205 (fadB1)
   01212 Fatty acid metabolism
    RHA1_ro04205 (fadB1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RHA1_ro04205 (fadB1)
   00650 Butanoate metabolism
    RHA1_ro04205 (fadB1)
  Lipid metabolism
   00071 Fatty acid degradation
    RHA1_ro04205 (fadB1)
   01040 Biosynthesis of unsaturated fatty acids
    RHA1_ro04205 (fadB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHA1_ro04205 (fadB1)
   00310 Lysine degradation
    RHA1_ro04205 (fadB1)
   00380 Tryptophan metabolism
    RHA1_ro04205 (fadB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RHA1_ro04205 (fadB1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RHA1_ro04205 (fadB1)
   00281 Geraniol degradation
    RHA1_ro04205 (fadB1)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    RHA1_ro04205 (fadB1)
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RHA1_ro04205 (fadB1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RHA1_ro04205 (fadB1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RHA1_ro04205 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4413630..4415768
Genome map
AA seq 712 aa AA seqDB search
MSEQNIINWEQDADGIVVLTIDDPNQGANTMNDAYISSMKATVDRLVDEKDSITGVVITS
GKKTFFAGGDLKNMIKVGPENADEIYSHSVAIKSDLRRLETLGKPVVAAINGAALGGGLE
IALATHHRVAADVKGVKIGLPEVTLGLLPGGGGVVRTVRMLGLQNALMQVLLQGQQRGPV
QAKEVGLIDEVVSSVEELVPAAKAWIKANPEGGVQPWDKKGYRIPGGTPSTPAFAANLPA
FPANLRKQLKGAPMPAPRAIMAAAVEGSQVDIDNALLIEARYFTSLVTGQVAKNMIQAFF
FDLQAINSGASRPEGIEKTPITKVGVLGAGMMGAGIAYVSAKAGFDVVLKDVTIEAANKG
KAYSEGIEAKALSRGKTTEEKSKTLLDRITPTADPADFAGVDFVIEAVFESQDLKHKVFQ
EIEDIVEPTALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIRGEKTSDE
ALARVFDYVQAIRKTPIVVNDSRGFFTSRVIGTFINEAIAMLAEGIEPATIEQAGMQAGY
PAAPLQLSDELNLTLMQKIRKETAEAAKAEGKELPADPAGDVINTMVDKFDRKGKLGGAG
FYDYADGKRTGLWPGLRENFGSKELEVPFQDLIERMLFIEAIETQKCFDEGVLLTTADAN
IGSIMGIGFPAWTGGVSQYIQGYEGGQAGFVKRAEELAAKYGERFTPPASLK
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagcagaacatcatcaactgggagcaggacgccgacggcatcgtcgtgctcacc
atcgacgatcccaaccagggcgcgaacaccatgaacgacgcctacatctcctcgatgaag
gcgaccgtcgaccgcctcgtcgacgagaaggactccatcaccggtgtcgtcatcacgtcc
ggcaagaagacgttcttcgccggcggcgacctgaagaacatgatcaaggtcggaccggag
aacgccgacgagatctacagccacagcgtcgcgatcaagtcggacctgcgccgcctcgag
acgctcggcaagcccgtcgttgccgccatcaacggtgccgcgctcggtggcggactcgag
atcgccctggccacgcatcaccgcgtcgccgcggacgtgaagggcgtcaagatcggcctg
cccgaggtcaccctcggcctgctgcccggtggcggcggcgtcgtgcgcaccgtccgcatg
ctcggcctgcagaacgcgctcatgcaggtgctgctccagggtcagcagcgtggaccggtg
caggccaaggaggtcggactgatcgacgaggtcgtgtcctcggtcgaggagctggttccc
gccgcgaaggcgtggatcaaggccaaccccgagggcggcgtccagccgtgggacaagaag
ggctaccggatccccggcggcaccccgtccaccccggcattcgcagccaacctgcccgcg
ttccccgcgaacctgcgcaagcagctcaagggtgctcccatgccggcaccgcgggccatc
atggccgccgccgtcgaaggttcgcaggtcgatatcgacaacgcgctcctcatcgaggcc
cgctacttcacgtcgctggtcaccggccaggtcgcgaagaacatgatccaggcgttcttt
ttcgacctgcaggccatcaactccggggcctcccgccccgagggcatcgagaagaccccg
atcaccaaggtcggtgtgctcggtgccggaatgatgggcgcgggcatcgcctacgtgtcc
gcgaaggccggcttcgacgtcgtcctcaaggacgtcaccatcgaggcagccaacaagggc
aaggcgtactccgagggcatcgaggccaaggccctctcgcgtggcaagaccaccgaggag
aagtcgaagacgctgctcgaccgcatcacgccgaccgccgaccccgccgacttcgccggt
gtcgacttcgtcatcgaggccgtgttcgagtcgcaggacctgaagcacaaggtgttccag
gagatcgaggacatcgtcgagccgacggccctgctcggctcgaacacgtcgaccctgccg
atcaccgggctggcgacgggtgtgaagcgtcaagaggacttcatcggaatccacttcttc
tcgcccgtcgacaagatgccgctcgtcgagatcatccgcggcgagaagacgtccgacgaa
gccctcgcgcgcgtcttcgactacgtgcaggccatccgcaagacaccgatcgtcgtcaac
gactcgcgcggcttcttcacctcccgcgtcatcggcaccttcatcaacgaggccatcgcc
atgctggcggagggcatcgagcccgccaccatcgagcaggcgggcatgcaggccggctac
ccggcggcaccgctgcagctgtccgacgaactgaacctcacgctgatgcagaagatccgc
aaggaaaccgcggaagctgcgaaggccgaaggcaaggaactgcccgccgatccggcaggc
gacgtcatcaacacgatggtcgacaagttcgaccgcaagggcaaactcggcggcgccggt
ttctacgactacgccgacggcaagcgcaccggcctgtggcccgggctgcgggagaacttc
ggttccaaggaactcgaggtcccgttccaggacctcatcgagcgcatgctgttcatcgag
gccatcgaaacgcagaaatgcttcgacgaaggcgtgctcctcaccaccgccgacgccaac
atcggctccattatgggtatcggcttccccgcctggaccggcggtgtgtcgcagtacatc
cagggctacgaaggcggccaggccggcttcgtcaagcgcgctgaagaactcgccgccaag
tacggtgagcgcttcaccccgccggcctcgctgaagtag

DBGET integrated database retrieval system