KEGG   Rhodococcus jostii: RHA1_ro04205Help
Entry
RHA1_ro04205      CDS       T00382                                 

Gene name
fadB1
Definition
(GenBank) fatty oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rha  Rhodococcus jostii
Pathway
rha00071  Fatty acid degradation
rha00280  Valine, leucine and isoleucine degradation
rha00281  Geraniol degradation
rha00310  Lysine degradation
rha00362  Benzoate degradation
rha00380  Tryptophan metabolism
rha00410  beta-Alanine metabolism
rha00640  Propanoate metabolism
rha00650  Butanoate metabolism
rha00903  Limonene and pinene degradation
rha00930  Caprolactam degradation
rha01040  Biosynthesis of unsaturated fatty acids
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
rha01212  Fatty acid metabolism
Module
rha_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RHA1_ro04205 (fadB1)
   00650 Butanoate metabolism
    RHA1_ro04205 (fadB1)
  Lipid metabolism
   00071 Fatty acid degradation
    RHA1_ro04205 (fadB1)
   01040 Biosynthesis of unsaturated fatty acids
    RHA1_ro04205 (fadB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHA1_ro04205 (fadB1)
   00310 Lysine degradation
    RHA1_ro04205 (fadB1)
   00380 Tryptophan metabolism
    RHA1_ro04205 (fadB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RHA1_ro04205 (fadB1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RHA1_ro04205 (fadB1)
   00281 Geraniol degradation
    RHA1_ro04205 (fadB1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RHA1_ro04205 (fadB1)
   00930 Caprolactam degradation
    RHA1_ro04205 (fadB1)
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RHA1_ro04205 (fadB1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RHA1_ro04205 (fadB1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RHA1_ro04205 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABG95996
UniProt: Q0S8Z0
Position
4413630..4415768
Genome map
AA seq 712 aa AA seqDB search
MSEQNIINWEQDADGIVVLTIDDPNQGANTMNDAYISSMKATVDRLVDEKDSITGVVITS
GKKTFFAGGDLKNMIKVGPENADEIYSHSVAIKSDLRRLETLGKPVVAAINGAALGGGLE
IALATHHRVAADVKGVKIGLPEVTLGLLPGGGGVVRTVRMLGLQNALMQVLLQGQQRGPV
QAKEVGLIDEVVSSVEELVPAAKAWIKANPEGGVQPWDKKGYRIPGGTPSTPAFAANLPA
FPANLRKQLKGAPMPAPRAIMAAAVEGSQVDIDNALLIEARYFTSLVTGQVAKNMIQAFF
FDLQAINSGASRPEGIEKTPITKVGVLGAGMMGAGIAYVSAKAGFDVVLKDVTIEAANKG
KAYSEGIEAKALSRGKTTEEKSKTLLDRITPTADPADFAGVDFVIEAVFESQDLKHKVFQ
EIEDIVEPTALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIRGEKTSDE
ALARVFDYVQAIRKTPIVVNDSRGFFTSRVIGTFINEAIAMLAEGIEPATIEQAGMQAGY
PAAPLQLSDELNLTLMQKIRKETAEAAKAEGKELPADPAGDVINTMVDKFDRKGKLGGAG
FYDYADGKRTGLWPGLRENFGSKELEVPFQDLIERMLFIEAIETQKCFDEGVLLTTADAN
IGSIMGIGFPAWTGGVSQYIQGYEGGQAGFVKRAEELAAKYGERFTPPASLK
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagcagaacatcatcaactgggagcaggacgccgacggcatcgtcgtgctcacc
atcgacgatcccaaccagggcgcgaacaccatgaacgacgcctacatctcctcgatgaag
gcgaccgtcgaccgcctcgtcgacgagaaggactccatcaccggtgtcgtcatcacgtcc
ggcaagaagacgttcttcgccggcggcgacctgaagaacatgatcaaggtcggaccggag
aacgccgacgagatctacagccacagcgtcgcgatcaagtcggacctgcgccgcctcgag
acgctcggcaagcccgtcgttgccgccatcaacggtgccgcgctcggtggcggactcgag
atcgccctggccacgcatcaccgcgtcgccgcggacgtgaagggcgtcaagatcggcctg
cccgaggtcaccctcggcctgctgcccggtggcggcggcgtcgtgcgcaccgtccgcatg
ctcggcctgcagaacgcgctcatgcaggtgctgctccagggtcagcagcgtggaccggtg
caggccaaggaggtcggactgatcgacgaggtcgtgtcctcggtcgaggagctggttccc
gccgcgaaggcgtggatcaaggccaaccccgagggcggcgtccagccgtgggacaagaag
ggctaccggatccccggcggcaccccgtccaccccggcattcgcagccaacctgcccgcg
ttccccgcgaacctgcgcaagcagctcaagggtgctcccatgccggcaccgcgggccatc
atggccgccgccgtcgaaggttcgcaggtcgatatcgacaacgcgctcctcatcgaggcc
cgctacttcacgtcgctggtcaccggccaggtcgcgaagaacatgatccaggcgttcttt
ttcgacctgcaggccatcaactccggggcctcccgccccgagggcatcgagaagaccccg
atcaccaaggtcggtgtgctcggtgccggaatgatgggcgcgggcatcgcctacgtgtcc
gcgaaggccggcttcgacgtcgtcctcaaggacgtcaccatcgaggcagccaacaagggc
aaggcgtactccgagggcatcgaggccaaggccctctcgcgtggcaagaccaccgaggag
aagtcgaagacgctgctcgaccgcatcacgccgaccgccgaccccgccgacttcgccggt
gtcgacttcgtcatcgaggccgtgttcgagtcgcaggacctgaagcacaaggtgttccag
gagatcgaggacatcgtcgagccgacggccctgctcggctcgaacacgtcgaccctgccg
atcaccgggctggcgacgggtgtgaagcgtcaagaggacttcatcggaatccacttcttc
tcgcccgtcgacaagatgccgctcgtcgagatcatccgcggcgagaagacgtccgacgaa
gccctcgcgcgcgtcttcgactacgtgcaggccatccgcaagacaccgatcgtcgtcaac
gactcgcgcggcttcttcacctcccgcgtcatcggcaccttcatcaacgaggccatcgcc
atgctggcggagggcatcgagcccgccaccatcgagcaggcgggcatgcaggccggctac
ccggcggcaccgctgcagctgtccgacgaactgaacctcacgctgatgcagaagatccgc
aaggaaaccgcggaagctgcgaaggccgaaggcaaggaactgcccgccgatccggcaggc
gacgtcatcaacacgatggtcgacaagttcgaccgcaagggcaaactcggcggcgccggt
ttctacgactacgccgacggcaagcgcaccggcctgtggcccgggctgcgggagaacttc
ggttccaaggaactcgaggtcccgttccaggacctcatcgagcgcatgctgttcatcgag
gccatcgaaacgcagaaatgcttcgacgaaggcgtgctcctcaccaccgccgacgccaac
atcggctccattatgggtatcggcttccccgcctggaccggcggtgtgtcgcagtacatc
cagggctacgaaggcggccaggccggcttcgtcaagcgcgctgaagaactcgccgccaag
tacggtgagcgcttcaccccgccggcctcgctgaagtag

DBGET integrated database retrieval system