KEGG   Rhodococcus jostii RHA1: RHA1_ro04211Help
Entry
RHA1_ro04211      CDS       T00382                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rha  Rhodococcus jostii RHA1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rha03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4420918..4421526
Genome map
AA seq 202 aa AA seqDB search
MYEGPVQDLIDELGKLPGVGPKSAQRIAFHLLSVEPPEIDRLKNALQRVRDGVQFCVVCG
TVSDKEHCRICADPRRDRTVICVVEEPKDVQAVERTREFKGRYHVLGGALDPLSGVGPDQ
LRIRELLARIGNQEDGVDVSEVIIATDPNTEGEATATYLVRMLRDFPGLTVSRLASGLPM
GGDLEFADELTLGRALSGRRTL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaaggtccggttcaggatctgatcgacgagctcggcaagctgcccggcgtcggg
ccgaagagcgcacagcgcatcgcgttccacctgctcagcgtcgagccgccggagatcgac
cggctcaagaatgcgctgcagcgggtgcgcgacggcgtccagttctgcgtggtgtgcggc
acggtctccgacaaggagcactgccgcatctgcgccgacccgcgccgtgaccgcacggtg
atctgtgtggtcgaggagccgaaggacgtccaggccgtcgagcgcacccgcgagttcaag
ggccgctatcacgttctgggcggtgcgctggatccgctgtccggggtgggccccgatcag
ctccgtatccgggagttgctcgcgcgcatcggcaatcaggaggacggcgtcgacgtctcc
gaggtgatcatcgcgaccgaccccaacaccgagggggaggccaccgcgacgtatctggtg
cggatgctgcgggacttccccgggctgacggtcagccggctcgcgtcgggtctgccgatg
ggcggcgacctcgagttcgccgacgagctcacgctgggcagggcgttgtcggggagacgc
acgctgtga

DBGET integrated database retrieval system