KEGG   Rhodococcus jostii: RHA1_ro04278Help
Entry
RHA1_ro04278      CDS       T00382                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rha  Rhodococcus jostii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHA1_ro04278
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHA1_ro04278
   00052 Galactose metabolism
    RHA1_ro04278
   00500 Starch and sucrose metabolism
    RHA1_ro04278
   00520 Amino sugar and nucleotide sugar metabolism
    RHA1_ro04278
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RHA1_ro04278
   00524 Butirosin and neomycin biosynthesis
    RHA1_ro04278
Enzymes [BR:rha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RHA1_ro04278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4502958..4503962
Genome map
AA seq 334 aa AA seqDB search
MALTIGIDVGGTKIAAGVVDTDGVIHRMVRRDTPSHDARRVENVIAELVRDLADTHPVQA
VGIGAAGFVAADLSTVLFAPNLAWRNEPLGEVVEAACGLPTVVENDANAAAWGEARFGAG
RTGQTVVVLTVGTGIGGGIVVDGVLHRGKFGVAAEFGHLNVEPHGRRCGCGNHGCWERYA
SGRALVREAQDLANVSPGFAADLLARAGGRADAITGLHITAAAQEGDPAALECFRVIGSW
LGHGMADIAAFFDPDLFIIGGGVCEAGELLRGPAAAAFENRLTGRAHRPVAEVRLAELGA
NVGIVGAADLARERILGLAHNGSRVSGGVQCPIG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggctctgacaattggcatcgacgtgggtggcacgaagatcgcagccggcgtggtcgac
accgacggagtcatccaccggatggtgcgtcgtgacaccccgtcccacgatgcgcgccgt
gtcgagaacgtcatcgccgaactcgtccgcgacctggcggatacccacccggtgcaggcg
gtcggcatcggcgcggccggcttcgtcgccgcggacctcagcaccgtgctcttcgccccg
aatctggcctggcgcaacgagcctctcggcgaggtggtcgaagcggcgtgcggactgccg
acggtggtggagaacgatgccaacgccgcggcatggggcgaggcgcgcttcggggccggg
cggacggggcagaccgtcgtcgtgctcacggtcggaaccgggatcggcggcggcatcgtc
gtcgacggcgtgctccatcgcggcaagttcggtgtggccgcggaattcgggcatctcaat
gtcgaaccgcacggtcgccgatgcggctgtggcaaccacggctgctgggagcgttacgcc
agtggccgggcgctcgtccgcgaggcgcaggatctggcgaacgtctcgcccggtttcgcc
gccgacctcctggcccgcgccggcggacgggcggacgccatcacgggcctgcacatcacc
gcggccgcgcaggaaggtgaccccgccgcgctcgagtgtttccgggtgatcggttcctgg
ctgggtcatggcatggcggacatcgcggcgttcttcgaccccgacctgttcatcatcggc
gggggagtgtgcgaggcgggcgaactgctgcgcggtcccgccgccgccgcgttcgagaac
cgtctcaccggacgcgcacaccgaccggtcgccgaggtgcgactggctgaactcggcgcg
aacgtcggcatcgtcggcgccgccgatctggcccgggaacgaattctcgggctcgcacac
aacggctcacgagtatctggaggagtgcaatgtccaatcggttga

DBGET integrated database retrieval system