KEGG   Rhodococcus jostii: RHA1_ro04305Help
Entry
RHA1_ro04305      CDS       T00382                                 

Gene name
choD
Definition
(GenBank) cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
rha  Rhodococcus jostii
Pathway
rha00984  Steroid degradation
rha01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    RHA1_ro04305 (choD)
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     RHA1_ro04305 (choD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C DAO GMC_oxred_N FAD_binding_2 Pyr_redox_2 NAD_binding_8 GIDA HI0933_like Amino_oxidase FAD_binding_3 Pyr_redox FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ABG96096
UniProt: Q0S8P0
Position
4535338..4537050
Genome map
AA seq 570 aa AA seqDB search
MTHYDVIVVGSGFGGSVAALRLTEKGYRVGVLEAGRRFADDELPETSWRLRRYLWAPWLG
CYGVQRIHLLPDVLVMAGAGVGGGSLNYANTLYQPPRRFFEDKQWAHITDWQSELAPYYE
QAKRMLGVTTNPSFTPADAVMREVAEEMGAGETFTSTPVGVFFGEPGSRVADPFFGGVGP
ERTGCTECGGCMTGCRVGAKNTLVKNYLHLAEKAGARVHPLTTVKELRPRSGGGYELRTR
RTDGIRKREHSFTADHVVVAAGTYGTARLLLAMKESGALPRLSPRLGSVVRTNSEAVLAA
TAKNRATDFTKGVAITSSFHPDDHTHIEPVRYGKGSNAIGLLQTVLSDGGGRTPRLLKTV
GVALRRPGAFVRSLSVRHWSERTVIALVMQTDDNSLELAKGRGRLGRAVTSRPGPGDPPP
EWIPQGHTAIRKVAERIGGDPGGSFADVVNIPMTAHFLGGCTIGDSPDTGVVDPYLRAYG
HDGLHVADGSVVSANLGVNPSLTITAQAERAFALWPNKGEADTRPEPGKPYVRIEPSPPR
NPVVPADAPGALRLPLTVTTRRETVHVERA
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcattacgacgtgatcgtggtcggctccggtttcggtggcagcgtcgcggcgctc
aggctgaccgagaaagggtatcgggtcggcgttctcgaagcgggcaggcgcttcgccgac
gacgagctgcccgagacgagctggcggctgcggcgttacctgtgggcgccgtggctgggc
tgctacggcgtgcaacggatccacctcctccccgacgtcctggtcatggccggggcgggg
gtcgggggtgggtcgctgaactacgcgaacaccctctaccagccgccgcgccgcttcttc
gaggacaagcagtgggcgcacatcaccgactggcagtcggagctggccccgtattacgaa
caggcgaaacggatgctgggcgtgacgaccaatccgtcgttcacccccgccgacgccgtc
atgcgtgaggtggccgaggagatgggcgcaggtgagacgttcacgtccacaccggtgggc
gtcttcttcggcgaaccggggtcgcgggtggccgatccgttcttcggcggagtagggccc
gagcgcacggggtgcaccgagtgcggcggttgcatgacgggttgccgtgtgggcgcgaag
aacacgctcgtcaagaattacctccacctcgccgagaaggcgggcgcccgggtccatccg
ctgacgacggtgaaggagttgcgcccgcgatcgggcgggggctacgagctgcggacccgc
cgcaccgacggcatccgcaagcgggagcactcgttcaccgccgaccacgtggtggtcgcc
gcaggcacgtacggcaccgcccggctgttgctggcgatgaaggaatccggtgcgctgccg
cggttgtcgccgaggctggggtcggtggtgcgcaccaattcggaggcggtcctcgcggcc
acggcgaagaaccgcgccaccgacttcacgaagggcgtggccatcacgtcctcgttccac
ccggacgatcacacccacatcgagcccgtgcggtacggcaagggcagcaacgcgatcgga
ctgttgcagaccgtcctcagcgacggcggcggcaggacgccgcggttgctgaagacggtc
ggcgtcgcgttgcgccgccccggggcgttcgtgcggagcctgtcggtgcggcactggtcg
gaacgcaccgtgatcgcgctcgtgatgcagaccgacgacaattcgctcgaactggccaag
gggcggggccgcctcggtcgcgcggtcaccagccgtcccggacccggagatccgccaccg
gagtggatcccgcagggtcacacggccatccgcaaggtggccgaacggatcggcggagac
cccggcggttcgttcgccgacgtcgtgaacattccgatgaccgcgcatttcctcgggggt
tgcaccatcggggactcgcctgacaccggcgtcgtagacccctacctccgggcgtacggc
cacgacggtctgcacgtggccgacggttccgtggtgagcgcgaacctcggcgtcaatccg
tcactcactatcaccgcccaagccgagcgtgcattcgcgctgtggcccaacaagggtgag
gccgacacccggcccgagccgggcaagccatacgtacgtatcgaaccgtcgccgccccgg
aatccggtggtacccgccgacgcgccgggtgcgctgcggctcccgctgacggtcaccacc
cgaagggaaacagtccatgtggagcgtgcctga

DBGET integrated database retrieval system