KEGG   Rhodococcus jostii: RHA1_ro04332Help
Entry
RHA1_ro04332      CDS       T00382                                 

Gene name
acsA2
Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rha  Rhodococcus jostii
Pathway
rha00010  Glycolysis / Gluconeogenesis
rha00620  Pyruvate metabolism
rha00640  Propanoate metabolism
rha00680  Methane metabolism
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHA1_ro04332 (acsA2)
   00620 Pyruvate metabolism
    RHA1_ro04332 (acsA2)
   00640 Propanoate metabolism
    RHA1_ro04332 (acsA2)
  Energy metabolism
   00680 Methane metabolism
    RHA1_ro04332 (acsA2)
Enzymes [BR:rha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RHA1_ro04332 (acsA2)
Lipid biosynthesis proteins [BR:rha01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RHA1_ro04332 (acsA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABG96122
UniProt: Q0S8L4
Position
complement(4561606..4563570)
Genome map
AA seq 654 aa AA seqDB search
MTSAAQASGATEKSEHSDSVPQVYPPSPEFTATANAGPDLQAAADEDRLAFWAKQAERLH
WHAPFSEVLDWSDAPVAKWFVNGRLNVAYNCVDRHVLAGNGDRVAIHFEGEPGDTRDLTY
NDLLAEVSKAANTFTDLGLVAGDRVAIYMPMIPEAIVTMLACARLGLTHSVVFAGFSASA
LRSRIDDAEAKLVVTVDGQWRRGQAAPLKPAVDEAVDGAESVKHVLVVKRTGIDVEVTEG
RDLWWHETVEKAEGTHQAQPFDSEHPLFILYTSGTTGKPKGIIHTSGGYLTQASYTHHNV
FDHKAGHDVYWCTADIGWVTGHSYIVYGPLSNGVTQVVYEGTPNSPDEHRHFQIIEKYGV
SIYYTAPTLVRTFMKWGRDIPDAHDLTSIRLLGSVGEPINPEAWKWFREVIGGNKAPIVD
TWWQTETGAIMISPLPGITATKPGSAMAPLPGISAKIVDDDANELGAGGSGYLVLDKPWP
AMLRGIWGDMDRYRETYWSRYPEQGWYFAGDGAKYDEDGALWVLGRVDDVMNVSGHRIST
SEVESALVGHHGVAEAAVVGAADETTGQGIVAFVILREGVENTGDTLIAELKAEVSREIS
PIAKPRQITIVPELPKTRSGKIMRRLLKDIAEGRDLGDTSTLVDPKVFDAIRGK
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtgcagcacaggcgagcggagcgacggagaagtcggaacattctgattccgtc
ccgcaggtgtatcccccgagccccgagttcaccgccacggcgaacgccggccccgacctc
caggccgccgccgacgaagaccgcctcgcattctgggcgaagcaggccgagcgcctgcac
tggcacgcccccttctccgaagtcctcgactggtccgacgcccccgtcgcgaagtggttc
gtgaacggacggctcaacgtcgcctacaactgcgtcgaccgccacgtcctcgcgggcaac
ggcgaccgcgtcgccatccacttcgagggcgaaccgggcgacacccgcgacctgacctac
aacgacctgctcgccgaagtcagcaaggccgccaacaccttcaccgacctcggactcgtc
gccggcgaccgcgtcgcgatctacatgccgatgatccccgaggccatcgtcaccatgctc
gcctgcgcccgcctcggcctgacccactcggtggtgttcgccggcttctccgccagcgcc
ctgcgctcacgcatcgacgacgccgaagccaagctcgtcgtcaccgtcgacggacagtgg
cgccgcggccaggccgcacccctcaagcccgccgtcgacgaggccgtcgacggcgccgag
tccgtcaagcacgtgctcgtcgtcaagcgcaccggcatcgacgtcgaggtcaccgagggc
cgtgacctgtggtggcacgagaccgtcgagaaggcggagggcacccatcaggcgcagccg
ttcgactccgagcacccgctgttcatcctgtacacctccggcaccaccggaaagcccaag
ggcatcatccacacctccggcggctacctcacccaggcgtcgtacacccaccacaacgtc
ttcgaccacaaggccggccacgacgtgtactggtgcaccgccgacatcggctgggtcacc
ggccacagctacatcgtctacgggccactctcgaacggtgtcacccaggtggtctacgag
ggcaccccgaactcccccgacgagcaccgccacttccagatcatcgagaagtacggcgtc
agcatctactacaccgcacccaccctggtgcgcaccttcatgaagtggggccgcgacatt
cccgacgcccacgacctgacctcgatccggctcctcggctcggtcggcgaaccgatcaac
cccgaggcctggaagtggttccgcgaggtgatcggcggaaacaaagccccgatcgtcgac
acctggtggcagaccgagaccggcgcgatcatgatctccccgctccccgggatcaccgcc
accaaacccggatcggcgatggcacccctgcccggtatctccgcgaagatcgtcgacgac
gacgccaacgaactcggcgccggcggctccggctacctcgtgctcgacaagccgtggccg
gcgatgctccgcggcatctggggcgacatggaccgctaccgcgaaacctactggtcccgc
taccccgagcagggctggtacttcgccggcgacggcgccaagtacgacgaggacggcgcc
ctgtgggtgctcggccgcgtcgacgacgtcatgaacgtctccggacaccgcatctccacc
tccgaggtcgaatccgccctcgtcggacaccacggtgtcgccgaggccgccgtcgtcggc
gccgcggacgagaccaccggccagggcatcgtcgcgttcgtcatcctccgcgagggcgtg
gagaacaccggcgacaccctcatcgccgaactcaaggccgaagtgtcccgggagatcagc
ccgatcgccaagccccgccagatcacgatcgtccccgaactccccaagacgcgctccggc
aagatcatgcgtcgcctgctcaaggacatcgccgaaggccgcgacctcggcgacacctcc
acgctcgtcgaccccaaggtcttcgacgcgatccgcggcaagtag

DBGET integrated database retrieval system