KEGG   Rhodococcus jostii: RHA1_ro04409Help
Entry
RHA1_ro04409      CDS       T00382                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rha  Rhodococcus jostii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RHA1_ro04409
Enzymes [BR:rha01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     RHA1_ro04409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4649939..4650796
Genome map
AA seq 285 aa AA seqDB search
MTVIELPSPGRTVVMGVLNVTTDSFSDGGRFLDRDAALARGLELKRLGVDIVDVGGESTR
PGAARVDPDVEAGRVAPVIADLVGEGICVSVDTMRASVAEAAIEAGASIINDVAGGRADA
AMASVVADAGVPWILMHWRSAADYVHRGTADHYDDVVREVRDELMTQVDLAVKAGVDPGS
LVLDPGLGFAKNADHNWALLKALPEFNELGFPVLIGASRKRFLGSLLADADGEPRPPAGR
EIATAVVSALAATHGAWGVRVHDAQGSLDAIAVAEAWAKGAAGRE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtgatcgagctgccctcgccaggccgaaccgtggtgatgggcgtcctgaacgtc
accaccgattccttctccgacggcggacgcttcctcgatcgtgacgccgcactcgcgcgc
ggtctcgagctgaagcgtctcggcgtcgacatcgtcgacgtcggtggcgagtccacccgc
ccgggcgcggcgcgggtcgatcccgacgtcgaagccggtcgcgtcgcacccgtgatcgcg
gatctggtgggcgagggcatctgcgtcagtgtcgacacgatgcgggcgtccgtcgcggag
gccgcgatcgaggcgggtgcgtcgatcatcaacgacgtcgccggtggccgcgcggatgcc
gcgatggcctcggtggtcgcggacgccggagtgccgtggatcctgatgcactggcgttcg
gctgccgactacgtgcaccgcggcaccgccgatcactacgacgacgtggtccgggaggtt
cgggacgagctgatgacccaggtcgacctggccgtgaaggccggggtggatccgggttcc
ctggtgctggatccgggtctgggttttgcgaagaacgccgaccacaactgggcgctgctg
aaggcgctgcccgagttcaacgagctgggattccccgtcctgatcggcgcgtcgcgcaag
cggttcctgggttcgctgttggcggatgcggacggggagccgcggccgcccgccggacgg
gagatcgcgaccgccgtcgtttcggcgctcgccgcgacccacggggcgtggggagtgcgc
gtgcacgatgcgcagggttccctcgacgccatcgcggtcgccgaggcctgggcaaagggt
gcagccggacgtgagtga

DBGET integrated database retrieval system