KEGG   Rhodococcus jostii RHA1: RHA1_ro04524Help
Entry
RHA1_ro04524      CDS       T00382                                 

Gene name
trpB2
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rha  Rhodococcus jostii RHA1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rha01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rha00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:rha00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4770092..4771408)
Genome map
AA seq 438 aa AA seqDB search
MTTSPVTGAELARSLESLGVAVPSAVPTHWYNLAADLPEPVPPHLHPGTREPLGPEDLAP
LFPASLIEQEVATERYIEIPETVREIYGMWRPSPLVRARRLERVLGTPARIYYKYEGVSP
VGSHKPNTAVAQAYYNALEGTTKLTTETGAGQWGASLSFAGALLGLEVEVWQVRASFDAK
PYRRLQMEAYGGICHPSPSDLTEAGRAILAEHPDTTGSLGMAISEAVEVAANDPGAHYSL
GSVLNHVMLHQTVIGQEALVQLEEAGEPVAHTVFGCAGGGSNLAGLTFPFLGRNLREGTT
TRLVACEPAACPSLTQGEYRYDFGDVAGLTPLLKMYTLGNDFVPPAIHAGGLRYHGMSPM
VSHAVALGLMDATAIEQDDALAAGLLFARAEGIIPAPESTHAVAAAIEHARTVTEPEVVV
IGLSGNGQLDLPAYSRYV
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
ttgaccacgtccccggtaaccggagccgaactggcgcgatcgctggaatctctgggggtt
gcggtcccctcggccgtgcccacgcactggtacaaccttgcagccgatcttccggaaccc
gttccgccgcatctgcatcccggcactcgtgagccgctcggaccggaagacctggcacct
ctgttccccgcgagcctgatcgagcaggaggtcgcgaccgaacggtacatcgagatcccc
gagacggtccgcgagatctacggcatgtggcggccgtcgccgctggtgcgcgcacgcagg
ctcgagcgagtgctcggcacgccggcacggatctactacaagtacgaaggtgtcagcccg
gtcggatcacacaagccgaacacggctgtggcacaggcctattacaacgcactcgagggc
accaccaagctcaccaccgagaccggcgcgggccagtggggcgcgtcgctgtcgttcgcc
ggcgccctgctcggcctcgaggtggaggtctggcaggttcgcgcctcgttcgacgccaag
ccgtaccgccgactccagatggaggcatacggcggcatctgtcatccgtctccgtccgac
ctgacagaagccggtcgggccatcctggccgagcaccccgacaccaccggttcgctgggc
atggcgatcagcgaggccgtcgaggtggccgccaacgatcccggcgcgcactactcgctg
ggcagcgtcctcaaccacgtcatgctccaccagaccgtgatcggccaggaagctctggtc
cagttggaggaggcgggtgagcctgtcgcgcacacggtattcggttgcgccggcggaggt
tccaacctcgcgggcctgacgttcccgttcctgggtcgcaatctgcgcgagggcaccacc
acccgcctcgtcgcgtgtgagccggcggcctgcccgtcgctgacgcagggcgagtaccgc
tacgacttcggggacgtcgcaggcctgacgccgctgttgaagatgtacaccctcggcaac
gacttcgttccgcccgccatccacgcgggcggactgcggtaccacggcatgtcgccgatg
gtctcgcacgccgtcgccctcgggctgatggacgcgaccgcgatcgaacaggacgacgca
ctcgccgcgggcctgctcttcgcccgcgccgaaggcatcatccccgcgccggaatccacg
cacgccgtggccgctgccatcgagcacgcccgcacggtcaccgaaccggaggtcgtggtc
atcggactgtccggcaacggccagctggacctccccgcgtacagccggtacgtctga

DBGET integrated database retrieval system