KEGG   Rhodococcus jostii: RHA1_ro04627Help
Entry
RHA1_ro04627      CDS       T00382                                 

Definition
cytochrome P450 (EC:1.14.-.-)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
rha  Rhodococcus jostii
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    RHA1_ro04627
  Amino acid metabolism
   00380 Tryptophan metabolism
    RHA1_ro04627
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RHA1_ro04627
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     RHA1_ro04627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4877007..4878503)
Genome map
AA seq 498 aa AA seqDB search
MPVTVLLDTGSVRGTLRTRHQFSNAGHIDTGVDMSVESLHTTADATIPHPRWRLPVVGDV
FGISIRTPLQNSMEIGRKLGPIFERNVLGNRFVFASGADMVAELSDESRFAKHLAPGVAS
LREVGGDGLFTAYNHEPNWSKAHNLLAPAFTKSAMRSYHRTMLDVAGELTEHWDERVDGS
PVDVSSDMTKLTLETIGRTGFSYSFDSFGRERPHPFVQAMVGALSHSQRTTFVKSSALGR
LLMRRSDRRNIANLEHMAEVVDEVIRARRDSAEDGPEDLLELMLRAARENDPHRIDELNI
RHQVVTFLVAGHETTSGALSFALYYLSRHPDVLAKAQAEVDAVWGDEEPAFEQIAKLRYV
RRVLDESLRLWPTAPAYGREATVDTTLVGKYPMKVGDWVLVLIPALHRDPVWGDDPEAFD
PDHFLPERIRSRPAHVYKPFGTGERACIGRQFALHESVLVLGTILRRYDIVGDPDYRLKV
AERLTLMPEGFTLQLRRR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgccagtcaccgtactgcttgacaccggttcagtaaggggtaccttgcgtactagacat
caattcagtaacgcaggccacatcgacacgggggtcgacatgagcgtcgaatcactgcac
accacggcggatgcgaccatcccgcatcctcgatggcggcttcccgtcgtcggcgacgtc
ttcgggatcagcatccgcactcccttgcagaattcgatggagatcggcagaaaactcggg
cccatcttcgagcgcaacgtcctcggcaatcggttcgtattcgcctccggtgccgacatg
gtcgcagaactctccgacgaatcccggttcgcgaaacacctcgcacccggcgtcgcgtcg
ttgcgcgaggtgggcggcgacggattgttcaccgcgtacaaccacgagccgaactggagc
aaggcgcacaacctcctcgccccggcgttcacgaaatccgcgatgcggtcgtatcaccgc
acgatgctggatgtcgcaggcgaactgacggagcactgggacgagcgggtggacggctcc
cccgtcgacgtgtcctccgacatgacgaagctgacgctcgagaccatcggccgcaccggc
ttcagctattccttcgactcgttcggacgcgagcgcccgcacccgttcgtgcaggcgatg
gtcggtgcgctgagccattcgcagcgcaccacgttcgtgaagtccagcgcgctcgggcgc
ctgctgatgcgacggtcggatcgacgcaacatcgccaacctcgaacacatggccgaggtc
gtcgacgaggtgatccgcgcccgccgcgacagcgccgaggacggtcccgaggacctgctc
gaactcatgctgcgggccgcccgggagaacgacccccatcgcatcgacgagttgaacatc
cgccaccaggtggtgacgttcctggtcgcgggacacgagaccacctccggtgcactgtcg
ttcgccctgtactacctgtcgcggcatcccgacgtcctcgcgaaggcgcaggcggaggtc
gatgcagtctggggcgacgaagagcccgcattcgagcagatcgcgaagctccgctacgtg
cgccgggtgctcgacgaatcgttgcggctgtggccgacagcccccgcgtacggcagggag
gcgaccgtcgacaccaccctcgtcggcaagtacccgatgaaggtcggcgactgggtgctc
gtcctcatccccgccctgcaccgcgaccccgtgtggggtgacgatcccgaggcgttcgac
cccgaccatttcctccccgagcgcatccggtcccgccccgcgcacgtgtacaagccgttc
gggaccggcgaacgcgcctgcatcggaaggcagttcgccctccacgagtcggtcctggtc
ctcggcacgatcctgcgtcgatacgacatcgtgggcgacccggactatcgactgaaggtc
gccgagcgcctcaccctcatgcccgagggcttcacgctgcagctccgccggcgttga

DBGET integrated database retrieval system