KEGG   Rhodococcus jostii: RHA1_ro04707Help
Entry
RHA1_ro04707      CDS       T00382                                 

Definition
reductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
rha  Rhodococcus jostii
Brite
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     RHA1_ro04707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4960974..4961984
Genome map
AA seq 336 aa AA seqDB search
MKVAVTGAAGFVGNNLLNLLVEAGHEVTAIDRVRSRYAPEYGVTWVNADVLDVESMKRAL
EGAEVVYHLVAMITLAQKDDLAWTVNTKGVRTVAEAALAVGVRRMVHCSSVHSFDQSSCG
GTLDENSPRSVDASIPVYDRSKWAGEIELREVVEAGLDAVICNPTGVYGPVDYGLSRVNA
LLRNAARGRVPAAVQGGFDFVDVRDVAAGLIAAGEKGRTGENYLISGHMLGMHDAVRRAA
RAAGRRGPLYSFPLSVIERVLPIAEPIGTRFGSDVLSRSAMSALLAAPVIDGSKARSELG
YVPRPADETIRDFVGFLVTSGQLSRGGQFSPVASSL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttgcagtaaccggcgccgcgggattcgtgggcaacaatctgctgaatctgctg
gtcgaggcggggcacgaggtgaccgcaatcgaccgcgtgcgttcccggtacgcacccgaa
tacggggtcacgtgggtgaacgccgacgtcctcgacgtcgaatccatgaagcgggcgctc
gagggcgccgaggtggtctaccacctggtcgcgatgatcaccctcgcccagaaggacgac
ctggcctggaccgtcaacaccaagggtgtgcgtaccgtcgccgaagccgctctcgcagtg
ggtgttcggcggatggtgcattgcagttccgtgcactccttcgatcagagcagttgcggc
ggaacgctcgacgagaactcgccccggtccgtcgacgcgtcgatcccggtgtacgacagg
tccaaatgggcgggcgagatcgaactccgcgaagtggtcgaggccgggctcgatgccgtg
atctgcaatcccaccggggtgtacgggcccgtcgactacggactgtcacgagtgaacgca
ttgctgcgcaacgccgctcgcggccgggttcccgcggcggtgcagggcgggttcgacttc
gtcgacgtccgagacgtcgccgccggactgatcgccgccggggagaagggccggaccggt
gagaactacctgatctcggggcacatgctcggcatgcacgatgccgtgaggagggctgcg
cgtgcggcgggtcgtcgggggccgctgtactcgttcccactcagcgtcatcgaacgcgtg
ctgccgatcgccgaaccgatcgggacccggttcggctccgacgtgctgtcgcggtccgcg
atgtcggcgctgctcgcggcgcccgtcatcgacggcagcaaggcgcggtccgaactcggc
tacgttccgcgtcccgccgacgagacgatccgcgacttcgtcggtttcctggtgacgtcc
ggtcagctgagccggggaggtcagttctccccggtcgcgtcctcgttgtag

DBGET integrated database retrieval system