KEGG   Rhodococcus jostii: RHA1_ro04778Help
Entry
RHA1_ro04778      CDS       T00382                                 

Definition
dehydrogenase (EC:1.1.1.-)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rha  Rhodococcus jostii
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RHA1_ro04778
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RHA1_ro04778
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     RHA1_ro04778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5046767..5047519)
Genome map
AA seq 250 aa AA seqDB search
MTEQNLTGRTALVTGGASGIGAACARTLAARGAHVTVADLDDVAAKSLADEIDGTAWHVD
LLDTDPLTELRLETDILVNNAGIQTISPIEEFRPEDFRRIQTLMVEAPFLLIRAALPHMY
STGFGRIINVSSVHGLRASAFKAAYVTAKHGLEGLSKVTALEGGPHGVTSNCVNPGYVLT
PLVQKQIADQAQVHGISEADVIEKVMLTESAIKRLVEPSEVASLVAWLASADAGMVTGAS
YTIDGGWTAR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcagaacctgaccggacgcaccgcgctcgtcaccggcggcgccagcgggatc
ggcgcggcctgcgcccggacgctcgccgcacgcggagcccacgtcacggtcgccgacctc
gacgacgttgccgccaagagtctcgccgacgagatcgacggaaccgcgtggcacgtcgac
ctcctcgacaccgatccgctcaccgaactgcggctcgagaccgacatcctcgtcaacaac
gccgggatccaaaccatcagtcccatcgaggaattccgccccgaggacttccggcgcatc
cagacgctgatggtcgaggcaccgttcctgctgatccgtgccgcgctgccgcacatgtat
tccacgggattcgggcgcattatcaacgtctcgtccgtgcacggcctccgcgcatcggcg
ttcaaggccgcatacgtcaccgccaagcacggactcgagggactgtcgaaggtgacggcg
ctcgagggcggtccgcacggcgtcaccagcaactgcgtcaatcccggttacgtgctgaca
ccgttggtgcagaagcagatcgcggatcaggcacaggtgcacggcatcagcgaggccgac
gtgatcgagaaggtgatgctcaccgagagcgcgatcaagcgactggtggaaccgtcggag
gtggcgtccctcgtcgcgtggctcgcatccgccgacgcaggcatggtcaccggcgcctcc
tacacgatcgacggaggatggaccgcccgctga

DBGET integrated database retrieval system