KEGG   Rhodococcus jostii RHA1: RHA1_ro04778Help
Entry
RHA1_ro04778      CDS       T00382                                 

Definition
dehydrogenase (EC:1.1.1.-)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rha  Rhodococcus jostii RHA1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rha00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:rha00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5046767..5047519)
Genome map
AA seq 250 aa AA seqDB search
MTEQNLTGRTALVTGGASGIGAACARTLAARGAHVTVADLDDVAAKSLADEIDGTAWHVD
LLDTDPLTELRLETDILVNNAGIQTISPIEEFRPEDFRRIQTLMVEAPFLLIRAALPHMY
STGFGRIINVSSVHGLRASAFKAAYVTAKHGLEGLSKVTALEGGPHGVTSNCVNPGYVLT
PLVQKQIADQAQVHGISEADVIEKVMLTESAIKRLVEPSEVASLVAWLASADAGMVTGAS
YTIDGGWTAR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcagaacctgaccggacgcaccgcgctcgtcaccggcggcgccagcgggatc
ggcgcggcctgcgcccggacgctcgccgcacgcggagcccacgtcacggtcgccgacctc
gacgacgttgccgccaagagtctcgccgacgagatcgacggaaccgcgtggcacgtcgac
ctcctcgacaccgatccgctcaccgaactgcggctcgagaccgacatcctcgtcaacaac
gccgggatccaaaccatcagtcccatcgaggaattccgccccgaggacttccggcgcatc
cagacgctgatggtcgaggcaccgttcctgctgatccgtgccgcgctgccgcacatgtat
tccacgggattcgggcgcattatcaacgtctcgtccgtgcacggcctccgcgcatcggcg
ttcaaggccgcatacgtcaccgccaagcacggactcgagggactgtcgaaggtgacggcg
ctcgagggcggtccgcacggcgtcaccagcaactgcgtcaatcccggttacgtgctgaca
ccgttggtgcagaagcagatcgcggatcaggcacaggtgcacggcatcagcgaggccgac
gtgatcgagaaggtgatgctcaccgagagcgcgatcaagcgactggtggaaccgtcggag
gtggcgtccctcgtcgcgtggctcgcatccgccgacgcaggcatggtcaccggcgcctcc
tacacgatcgacggaggatggaccgcccgctga

DBGET integrated database retrieval system