KEGG   Rhodococcus jostii: RHA1_ro04830Help
Entry
RHA1_ro04830      CDS       T00382                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rha  Rhodococcus jostii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RHA1_ro04830
Enzymes [BR:rha01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     RHA1_ro04830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5097704..5099809
Genome map
AA seq 701 aa AA seqDB search
MTYTEQLRDLAARHGVATSYRGWDQQRRDVRDDTLRSVLAALDVPAATEDEVRRALSECD
AAPWRRMLPPVVVGREGSETRFVVHVPHGSAVDVTIDTESGGTVPARQLQVWVDPREVDG
ALVGRATFVVPSDVPCGWHTLRASTSHTSSSCTLVVTPDRLSTSDALSDRRRWGVLTQLY
SIRSHRSWGVGDFGDLADLATIFGSVHGADYVLVNPLHAAQPRPPIEASPYLPTTRRYVN
PMYIRVENIPETAYLSTRRHARMREAAARFERANDRSDRIDRNPSYRAKLRVLERVFRIE
RSPSRQHAFEEFCRVEGDGLRDFATWCALTEKLPPDDPRWTTQAGAPDSDWVRAQQRKLA
PRIEFYSWLQWVCDEQLSDAQDAARAAGMDIGIVHDLAVGVQRGGADAWSLGTALAEGIT
VGAPPDDFNQQGQQWNQPPWRPDRLAELGYAPYRDMLRTVLKHAGGLRVDHILGLFRLWW
IPADAESPADGTYVSYDHEALVGILALEAERAGAVVIGEDLGVFEPEVQDYLAERGILGT
SILWFEHDGERPTPPEQYRTLCLTSVTTHDLPPTAGYLAGEHIELRSRLGLLERDLELEK
EHDARQREAVLQLARDRGLLADDASIPDTVKALYRLINRSPSLLTGVALADLVGEYRVQN
QPGTDEAQYSNWKIPLADAAGRAVHVEDLADGDFGFVGSAR
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtacaccgagcagttgcgtgacctcgcggcccggcacggggtggcgacgtcgtac
cggggttgggatcagcagcgccgcgacgtgcgtgacgacacactccgcagcgtcctcgcg
gccctggacgttcccgccgcaacggaggacgaggtgcggcgcgccctgtccgaatgcgac
gcggcaccgtggcgacggatgctgccgcccgtcgtcgtcggcagggaagggtccgagacc
cgtttcgtggtccacgttccgcacggctcggcggtggacgtcacgatcgacacggagtcc
ggcggcacggtcccggcacgccaactccaggtgtgggttgatccgcgggaggtcgacggc
gccctggtcggccgcgcgacgttcgtcgtcccctccgacgttccgtgcgggtggcacacg
ctgcgggcttcgacctcgcacacgtcctcgtcgtgcacgctcgtggtgacgccggaccga
ttgtcgacgtccgacgcgctcagcgaccgccgacgctggggtgtgctcacgcagttgtac
tcgatccggtcgcatcggtcctggggtgtcggggacttcggcgacctcgcggatctcgcc
acgatcttcggttccgtgcacggcgccgactacgtgctggtcaatccactgcacgccgcc
cagccccggccaccgatcgaagcgtcgccgtatctgccgaccacgcgccgctacgtcaac
ccgatgtacatccgtgtcgagaacatcccggagacggcgtacctctcgacgcgtcgccat
gcgcggatgcgcgaggccgcagcgcgattcgagcgggcgaacgaccggtccgaccggatc
gatcgcaacccgtcgtaccgggccaaactccgcgtgctcgaacgggtcttccggatcgag
cgcagcccgagcaggcagcacgcgttcgaggagttctgccgcgtcgagggcgacggactg
cgggacttcgcgacctggtgcgcgctgaccgagaaactgccgcccgacgacccgcgatgg
acgacgcaggccggtgcgcccgacagcgactgggtgcgggcgcagcagcgcaagctcgcg
ccgcgaatcgagttctactcgtggctgcaatgggtatgcgacgagcagctttccgacgcc
caggacgcggcgcgggcggcaggcatggacatcgggatcgtgcacgatctggcggtcggg
gtccagcgcgggggtgcggacgcgtggtcgctgggaacggccctggcagagggcattacc
gtcggcgctccccccgacgacttcaatcagcagggtcagcaatggaatcagccgccctgg
cgaccggatcggctggccgaactggggtatgccccgtaccgcgacatgctgcgcaccgtg
ctgaagcacgcgggtgggctgcgggtcgatcacatcctggggctgttccggctgtggtgg
atccccgccgatgcggagtcgcctgcggacggaacgtacgtctcctacgaccacgaggct
ctcgtcggaatcctcgcgctcgaggcggagcgggcgggcgccgtggtgatcggtgaggac
ctcggggttttcgaacccgaggtccaggactacctcgccgagcgcggaatcctggggacg
tcgatcctgtggttcgagcacgacggcgagcggccgacaccgccggagcagtaccggacc
ctgtgcctgacatccgttaccacgcatgatcttccgccgaccgccggatacctggccggc
gaacacatcgaattgcgctcgcggctcgggctcctcgaacgcgacctcgaactcgagaag
gaacacgacgcccggcagcgtgaggccgtactgcaattggcgcgcgaccgcggactgctg
gccgacgacgcgtcgatacccgacaccgtgaaggcgttgtaccggctgatcaaccgcagc
ccgtcgctgctgacgggtgtcgcgctcgccgatctggtgggggagtaccgcgtccagaat
cagccgggcaccgacgaggcccagtattcgaattggaagattcccctcgccgacgcggcg
gggcgtgccgtacacgtcgaggacctggcggacggcgatttcgggttcgtgggcagcgcc
cgctga

DBGET integrated database retrieval system