KEGG   Rhodococcus jostii RHA1: RHA1_ro05010Help
Entry
RHA1_ro05010      CDS       T00382                                 

Gene name
asn2
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rha  Rhodococcus jostii RHA1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rha00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5290799..5292640
Genome map
AA seq 613 aa AA seqDB search
MCGIAGWISFERDLRVEQSTVDAMAETMNCRGPDDRGTWVVERAALGHRRLAIIDLPGGH
QPMSVDTPGGTVAMVYSGEVYNFGELHEELYRRGHRFATDSDTEVVLHGYLEWGEAVAER
LNGMYAFAIWDSRTDTLVMIRDRMGIKPFYYYETRDGVLFGSEPKAILANPIAESTVTMD
GIRELFAFVKTPGHAVWDGMREVEPGTVVTVSRTGLRTHRYWTLQTRPHTDDRDTSVAHV
RELLDDIVRRQLVADVPRCTLLSGGLDSSAMTGIAAEQLAEVGETVRTFAVDFVGQTEHF
VADELRGTPDTPYVHDVARRSRTAHQDIVLDSDALADPAVRAKVIRARDIPMGLGDMDAS
LYLLFKAIRQHSTVALSGESADEVFGGYKQFFDPKAQQANTFPWLVQFAEHFGDESNIFT
PEVTAGLNMDDYVQDSYDAAVSGIDRLDGESDFEWRMRKICYLHLTRFVRVLLDRKDRAS
MAVGLEVRVPFCDHRLVEYVYNTPWSLKTFDGKEKSLLRAATRDVLPQSVIDRVKSPYPS
TQDPKYAVALQQHGKDLLSDPSHPVFGLVSADWLSRAVSVDTPQISQVSRRGLERTLDLA
LWMDMYNPTIKLS
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgccggatggatctcgttcgaacgcgatctacgcgtcgaacagtccacc
gtggatgccatggccgagacgatgaactgccggggaccggacgatcgcggtacctgggtc
gtcgaacgcgccgcgctcgggcatcgaaggctcgcgatcatcgatctgccgggtgggcat
cagccgatgagcgtggacacccccggtgggaccgttgcgatggtctactccggtgaggtg
tacaacttcggtgaactgcacgaggagttgtaccggcgcggtcaccggttcgccaccgac
tccgacaccgaggtggtgctccacggatacctggagtggggagaggccgtcgcggagcgg
ctcaacggcatgtatgcgttcgccatctgggattcgcggaccgacacactcgtgatgatc
cgcgaccggatgggcatcaagccgttctactactacgagacccgagacggcgtcctgttc
ggttcggaacccaaggcgatccttgccaatccgatcgccgagtcgaccgtcacaatggac
gggatccgggagctgttcgcgttcgtgaagacaccgggacacgccgtgtgggacggcatg
cgtgaggtggaaccgggcacggtggtcaccgtctcgcgcaccggactgcgaacgcaccgg
tactggaccctgcagacccgcccgcacaccgacgaccgggacacctccgtcgcgcacgtc
cgcgaactcctcgacgacatcgtgcggaggcaactggtcgccgacgtgccgcgctgcacc
ctgctgtccggtggtctcgactcgtccgcgatgaccggcatcgccgccgagcagctcgcc
gaggtaggtgagactgttcgcacgttcgccgtcgacttcgtcggtcagaccgaacatttc
gtagccgacgaactgcggggcaccccggacactccgtacgtgcacgacgtggcccggcga
tcccggaccgcgcaccaggacatcgtcctcgactccgacgcactggcggaccccgccgtg
cgcgcgaaggtcatccgggcacgtgacatccccatgggcctcggcgacatggacgcgtcg
ctgtatctgctgttcaaggcgatccgtcagcactccacggtggcgctgtccggtgagtcg
gccgacgaggtgttcggcggatacaaacagttcttcgacccgaaggcgcagcaggcaaac
accttcccgtggctcgtgcagttcgccgagcacttcggcgacgagagcaacatcttcacc
ccggaggtcacggcggggctgaacatggacgactacgtgcaggactcgtacgacgcagcg
gtgtccgggatcgaccggctggacggcgaatccgacttcgagtggcggatgcgcaagatc
tgctacctccatctgacgcggttcgtccgggtcctgctcgaccgcaaggaccgcgcgagc
atggccgtcggactcgaggtccgggtgccgttctgcgatcaccggttggtggagtacgtc
tacaacacgccgtggtcgctgaagacgttcgacggcaaggagaaatcgttgctgcgggcg
gcgaccagggacgtgctgccgcagtcggtgatcgaccgggtgaagtcgccgtacccgtcc
acccaggacccgaagtatgcggtggcgttgcagcagcacggcaaggacctgctcagcgac
ccctcgcacccggtgttcggcctggtcagtgcggactggctgtcccgggcggtgtccgtc
gacaccccacagatcagtcaggtgtcgcggcgcggactcgagcgcacgctcgacctcgcg
ctgtggatggacatgtacaacccgacgatcaaactgtcttag

DBGET integrated database retrieval system