KEGG   Rhodococcus jostii: RHA1_ro05196Help
Entry
RHA1_ro05196      CDS       T00382                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rha  Rhodococcus jostii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RHA1_ro05196
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    RHA1_ro05196
Enzymes [BR:rha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RHA1_ro05196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5541510..5542685
Genome map
AA seq 391 aa AA seqDB search
MRIKYALALAACTGLVAGCSSGGGETVAESSSTTPSPSSVEPASHTGTAAPAAAPASCET
EFLQSLPLRRKLAQLLNVGVTGTADAAQVVRDEQIGGIFVGSWTDEAMLANREIPQVASA
SSLPLMVTIDEEGGRVSRVENLLGADPSARQTAATMTEEQTYQMALERGRGLKDLGVTVN
FAPDVDVSSQPDDSVIGDRSYSDDPAVVTRYADAYARGMRDAGILPVIKHFPGHGSASGD
SHTGAVTTPPLDQLQTKDLVPFRNLVSTGVGVMLGHLEVPGLTAPGVPASISPDAVALLR
GGTGYGAPPFTGPIFTDDLSGMQAITDRYDITVAVETALESGVDVALWLTTDDVPRVLDH
LESVVASGKLPQQRVDEAVLTVAQAKGVLAC
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcaagtatgcactcgcgctcgctgcctgtaccggcctcgtcgccggatgttcg
tcgggtggtggcgagacggtcgcggagtcgtcgtcgacgacaccgtcgccgtcctccgtc
gagccggcgtcgcataccggcaccgcagcgcccgcagccgcgccggcgtcgtgcgagacg
gagttcctgcagtctttgccgttgcggcgcaagctcgctcagctgctgaacgtgggagtg
accggcaccgcggatgcggctcaggtggtccgtgacgagcagatcggcggcatcttcgtc
ggaagctggaccgacgaggccatgctcgcgaaccgtgagattccccaggtggcgtcggcg
tcgtcgctgccgctgatggtgacgatcgacgaggagggtgggcgcgtgtcgcgcgtcgag
aacctgctcggagccgatccgtccgcccggcagaccgcagccacgatgacggaggagcag
acgtaccagatggcgctcgagcgcggtcgtggactgaaggacctcggtgtcaccgtgaac
ttcgcccccgacgtggacgtgagcagtcagcccgacgacagcgtgatcggcgaccgctcc
tactccgacgatcccgccgtcgtcacccgctacgcggacgcgtacgcgcgcggaatgcgg
gacgcgggaatcctgcccgtcatcaagcacttccccggccatggatcggcgtccggcgac
tcgcacaccggggccgtcaccaccccgcctctcgaccagttgcagacgaaggacctcgtc
ccgttccggaacctggtgtccacgggagtcggcgtcatgctcggtcacctcgaggtgccg
ggtctgaccgcgcccggggttcccgccagcatcagtcccgacgcggtggcgctgctgcgc
ggcggcaccggatacggggcgccgccgttcaccggaccgatcttcaccgacgacctcagc
ggcatgcaggcgatcaccgatcggtacgacatcaccgtcgccgtcgagaccgcgctggaa
tccggtgtcgatgtcgccctgtggctcaccaccgacgacgtcccgcgggtgctcgatcac
ctcgaaagcgttgtggcctcgggcaagctgccgcagcagcgtgtcgacgaggcggtcctg
accgtcgcgcaggccaagggcgtcctcgcctgctag

DBGET integrated database retrieval system