KEGG   Rhodococcus jostii: RHA1_ro05437Help
Entry
RHA1_ro05437      CDS       T00382                                 

Gene name
galU1
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rha  Rhodococcus jostii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RHA1_ro05437 (galU1)
   00052 Galactose metabolism
    RHA1_ro05437 (galU1)
   00500 Starch and sucrose metabolism
    RHA1_ro05437 (galU1)
   00520 Amino sugar and nucleotide sugar metabolism
    RHA1_ro05437 (galU1)
Enzymes [BR:rha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RHA1_ro05437 (galU1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5804181..5805083
Genome map
AA seq 300 aa AA seqDB search
MGELDSAGFRTAVVPAAGMGTRFLPATKTVPKELLPVVDTPGIELVAGEAAESGAERLII
VTAPGKDGVVAHFVEDLVLENNLAARGKHALLEKVRRAPGLLAVESVVQQQPLGLGHAVG
CAEAVLGDDEDAIAVLLPDDLVLPNGVLDVMSRVRAKRGGTVLCAIDVPKEEVSAYGVFD
VEMVPDVVNPNVLRVKGMVEKPKLQDAPSTLAAAGRYLLDRAIFDALRRIRPGAGGELQL
TDAIALLISEGHPVHVVVHRGPRHDLGNPGGFLRASVDLALSHPEYGADLRTWLENRVKG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgggggaattggattcggctggatttcgcacggctgtggtgccagccgcggggatggga
acacgatttttgccggcgacaaagacggtccccaaggagctgcttcctgtggtggatacg
cccgggatcgagctggtggccggcgaggctgccgagtcgggagcagagcggctgatcatc
gtgacggcaccaggcaaggatggtgtggtggcgcacttcgtcgaagatctggtgttggaa
aacaaccttgctgcccggggaaaacacgctctgctggagaaggtccgcagggcgccgggc
ctcctggcggtggagtcggtagtccagcaacaaccgctggggctcggccacgcggttggt
tgcgctgaagcggtgctgggcgacgacgaggatgcgatcgcggttctgctaccggacgac
ttggtactgccgaatggcgtgctcgacgtcatgtcgcgcgtgcgagcgaagcgtggcgga
acggtgttgtgtgccatcgacgtcccgaaggaggaggtgagcgcatatggagtcttcgac
gtcgagatggtccccgatgtcgtgaatccgaacgtattgagggtgaagggcatggtggag
aagccgaaactccaggacgcgccgtcgactctcgcggccgcaggccgttacctcttggat
agggcaatctttgatgcgctccgacgaattcgcccgggagcgggcggcgaattgcagttg
accgacgcgatcgcgctgctcatctcggaagggcatcccgtacacgtagtagtccatcgt
gggccccggcacgacctcggcaatcccggggggttcctccgcgcatccgtggatctggcg
ctcagtcatcccgaatatggggcggacctccgaacgtggctggagaatagggttaagggc
tag

DBGET integrated database retrieval system