KEGG   Rhodococcus jostii: RHA1_ro05573Help
Entry
RHA1_ro05573      CDS       T00382                                 

Gene name
sucC
Definition
(GenBank) succinate--CoA ligase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rha  Rhodococcus jostii
Pathway
rha00020  Citrate cycle (TCA cycle)
rha00640  Propanoate metabolism
rha00660  C5-Branched dibasic acid metabolism
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
Module
rha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RHA1_ro05573 (sucC)
   00640 Propanoate metabolism
    RHA1_ro05573 (sucC)
   00660 C5-Branched dibasic acid metabolism
    RHA1_ro05573 (sucC)
Enzymes [BR:rha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RHA1_ro05573 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABG97353
UniProt: Q0S533
Position
5995893..5997062
Genome map
AA seq 389 aa AA seqDB search
MDLFEYQAKELFAKHEVPTSAGRVTDTVAGAREIAEEIGKPVMVKAQVKVGGRGKAGGVK
YSADADAAQANAEAILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRTNRTYLAMCSVE
GGVEIEVTAEENPDALAKIPVDAVKGVDLAFARSIAEAGKLPAEVLDAAAVTIQKLWEVF
INEDALLVEVNPLVRTPDDQILALDGKVTLDENAAFRQPGHEAFEDKDATDPLELKAKEN
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMANGLD
VILNDAQVKSVFVNVFGGITACDAVANGIVGALKTLGDEANKPLVVRLDGNNVEEGRRIL
AEAAHPLVTVVGTMDEAADKAAELAFAAK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggatctcttcgaataccaggcgaaggaactcttcgccaagcacgaggtgccgacttcg
gctgggcgtgttaccgacacggtcgccggcgcacgcgagattgccgaagaaatcggcaag
cccgtgatggtcaaggcgcaggtcaaggtcggaggccgcggcaaggccggcggcgtcaag
tactccgccgacgccgatgccgcccaggccaacgccgaggcgatcctgggcctcgacatc
aagggtcatgtcgtcaagaagctgctggtcgcagaggcgagtgacatcgccgaggagtac
tacatctccttcctgctcgaccgcaccaaccgcacctacctggccatgtgctcggtcgag
ggtggcgtcgagatcgaggtcaccgccgaggagaaccccgacgctctcgcgaagatcccc
gtggacgccgtcaagggtgtcgacctcgcgttcgcgcgcagcatcgccgaggcaggaaag
ctgcccgccgaggtgctcgacgcagcggccgtgacgatccagaagctgtgggaggtcttc
atcaacgaagacgctctcctcgtcgaggtcaacccgctcgtccgcacgccggacgaccag
atcctcgcgctcgacggcaaggtcacgctggacgagaacgctgcgttccgtcagcccggc
cacgaggcgttcgaggacaaggacgccacggacccgctcgagctcaaggccaaggaaaac
gacctcaactacgtcaagctcgacggtgaggtcggcatcatcggtaacggcgccggcctg
gtcatgtcgaccctggacgtcgtcgcctacgcaggtgagaagcacggtggcgtgaagccg
gccaacttcctcgacatcggtggcggtgcctccgcagaggtcatggcgaacggcctggac
gtcatcctgaacgacgcgcaggtcaagagcgtgttcgtgaacgttttcggtggcatcacc
gcgtgtgacgcggtcgccaacggcatcgtcggcgccctgaagacgctcggtgacgaggcc
aacaagccgctggtcgtccgcctggacggcaacaacgtcgaagagggtcgtcgtatcctc
gccgaggccgcccacccgctggtcacggtcgtcggaaccatggacgaggctgccgacaag
gctgccgagctggccttcgccgcaaagtaa

DBGET integrated database retrieval system