KEGG   Rhodococcus jostii: RHA1_ro05589Help
Entry
RHA1_ro05589      CDS       T00382                                 

Definition
(GenBank) probable magnesium chelatase subunit chlI
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rha  Rhodococcus jostii
Pathway
rha00860  Porphyrin and chlorophyll metabolism
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RHA1_ro05589
Enzymes [BR:rha01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RHA1_ro05589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase Sigma54_activat AAA_5 AAA_PrkA AAA_3 MCM AAA_16 NACHT AAA_22 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ABG97369
UniProt: Q0S517
Position
6010114..6011502
Genome map
AA seq 462 aa AA seqDB search
MVTSSEHRPSTVGELRESGHVQRTVKEEIRENLLAALRDGRDPWPGIVGFEETVEPQLER
ALIAGHDVVLLGERGQGKTRLLRTLNLLLDEWTPVIAGSELGEHPYEPITPASIRRAQEL
GDTLPVAWRHRSERYSEKLATPDTSVADLVGDVDPVKVAEGRSLGDPETIHFGLVPRAHR
GIVAINELPDLAERIQVSLLNVMEERDIQVRGYTLRLPLDVLMVASANPEDYTNRGRIIT
PLKDRFGAEIRTHYPTRLDDEVAVILQEAHLTAEVPEYLLEILARFTRLLRESTSVDQRS
GVSARFAVAGAETVSAAAVHRGAVLGEADPVARPVDLETVVDVLRGKVEFESGEEGREIE
VLEHLLRRATADTVRTRLGGIDLAELVDAVEQGDPVVTGERITAKALLNELPELEVLDEL
AERLGAESDGERAAAAEFALEGLYLARRISKNPDINGQTVYS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtggtgacgtcatcggaacacagaccttccaccgtcggcgagctccgcgagtcgggccac
gttcaacgcaccgtcaaggaggagatccgcgagaatctgctcgcggccctacgcgacggt
cgtgatccgtggcccggcatcgtcggtttcgaggagacggtggaaccacagctcgaacgg
gctctcatcgcgggtcacgacgtggtgttgctcggcgaacgtggtcagggcaagacccgc
ctcctccgcaccctcaatctgctcctcgacgaatggaccccggtgatcgccggttccgaa
ctcggggagcatccctatgagcccatcaccccggcgtcgatccgccgggcgcaggaactg
ggcgacaccctccccgtcgcgtggcggcaccgcagcgagcggtattcggagaaactcgcg
acccccgacacgtcggtggcggacctcgtcggcgacgtggatccggtcaaggtcgcggag
ggccggagtctcggcgacccggaaaccattcacttcgggctcgttccccgcgcccaccgg
ggcatcgtcgccatcaacgaactgcccgacctcgccgaacgcatccaggtgtcgctgctc
aacgtcatggaggaacgcgacatccaggtccgcgggtacaccctccggctcccgctggac
gtcctgatggtggccagcgcgaacccggaggactacacgaaccgcggtcgcatcatcacc
ccgttgaaggaccggttcggtgccgagatccgcacccactacccgacccggctcgacgac
gaggtcgcggtcatcctgcaggaagcgcatctcaccgcggaggtgcccgagtacctcctc
gagatcctggcccgattcacccgtctgctccgagagtcgacgtcggtcgatcagcggtcg
ggtgtgtccgcccgcttcgctgtggcaggcgccgaaaccgtcagcgccgctgcggtgcat
cgcggcgccgtgctcggtgaggcagatccggtcgcgcggcctgtcgacctcgagaccgtc
gtcgacgtgctgcggggcaaggtggaattcgaatccggtgaggaggggcgcgagatcgag
gtcctggagcacctgctccggcgggcgacggccgacacggtccgcacccggctcggcggc
atcgacctggcggaactcgtggacgcggtcgagcagggcgacccggtggtgaccggtgag
cggatcacggcgaaggcgctgctgaacgagctgcccgaactcgaggtcctcgacgagctg
gcagagcgtctcggcgcggagtccgacggcgagagggccgcggccgccgagttcgccctc
gaagggctgtacctggcgcggcggatctcgaagaacccggacatcaacgggcagacggtg
tattcgtaa

DBGET integrated database retrieval system