KEGG   Rhodococcus jostii: RHA1_ro05684Help
Entry
RHA1_ro05684      CDS       T00382                                 

Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rha  Rhodococcus jostii
Pathway
rha00900  Terpenoid backbone biosynthesis
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01130  Biosynthesis of antibiotics
Module
rha_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RHA1_ro05684
Enzymes [BR:rha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RHA1_ro05684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABG97463
UniProt: Q0S4S3
Position
6104983..6105918
Genome map
AA seq 311 aa AA seqDB search
MLSVVPRPVVVRAPSKVNLHLAVGDLRDDGYHELNTVFQALSLSDTVSVAPAETLSVTVR
GEDARVVPTDSSNLVWQAAEMLAAESGRRPDVEIAIDKGIPVAGGMAGGSADAAATLVGL
NALWQLDLSREELDGFAAKLGSDVPFSLHGGTAVGTGRGERLLPVLSRSTFHWVLALAKV
GLSTPTVFRELDRLRADGNPPRLGGPEDLMHALTTGDAATLAPLLGNDLQSAALSLNPGL
RRTLRAGVAAGALAGIVSGSGPTCAFLCAEADAAVRVSAELAGAGVCRTVRVASGPVPGA
RIINDAAEGSH
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgctttccgtcgttcctcgccccgtcgtagtcagggccccgtccaaggtcaatctgcat
ctggccgtcggggacttgcgtgacgacggctatcacgagctgaacacggtgttccaggcg
ctctcgctcagcgacacggtgtcggtggcccccgcggagacgctgtcggtgacggtccgc
ggtgaggacgcccgcgtcgtgccgaccgacagcagcaacctcgtgtggcaggccgccgag
atgctcgcggccgagtcggggcggcgcccggacgtcgagatcgccatcgacaagggcatc
ccggtggccgggggcatggccggcggcagcgcggacgccgcggcgacgctggtcgggctg
aacgcgctgtggcaactcgacctgtcgcgggaggaactcgacgggttcgccgcgaagctc
ggcagcgacgttccgttctccctccacggtggcaccgcggtcggcacgggacgcggcgag
cgacttctgccggtgctctcccgcagcacgttccactgggtgctcgcgctcgcgaaggtc
ggcttgagcacaccgaccgtgttccgggagctggaccggttgcgtgccgacgggaatccg
ccgcgactcggcggacccgaagacctgatgcacgcgctaacgacgggcgacgccgcgacg
ctggccccgttgctgggcaacgatttgcagtcggccgcgctgtcgctgaatccgggcctg
cggcggacgctgcgagccggggtcgcggcgggcgcactggccggaatcgtctccgggtcc
ggtccgacctgtgcctttctttgtgctgaagcggatgccgcggtccgggtcagcgcagaa
ctcgcaggtgcgggggtgtgtcgcacggtgcgggtcgccagcggacccgtaccgggcgcc
cgaataatcaacgacgcggcggagggatcgcactga

DBGET integrated database retrieval system