KEGG   Rhodococcus jostii: RHA1_ro05698Help
Entry
RHA1_ro05698      CDS       T00382                                 

Definition
hypothetical protein
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
rha  Rhodococcus jostii
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    RHA1_ro05698
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other, unknown, acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     RHA1_ro05698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(6120658..6122130)
Genome map
AA seq 490 aa AA seqDB search
MVDATPIRPRSATTVTEWDYEADVVVAGYGIAGVAASIEAARAGADVLVLERTSGWGGAA
ALAGGFIYLGGGTPLQKACGFDDSPENMKTFMMAALGPGADEEKITDYCEGSVEHYNWLV
DCGVPFKESFWGEPGWEPPFDDGLMYSGGENAAPFNEIATPAPRGHVPQMDGKRTGEKGG
GYMLMKPLVETAEKLGVRAEYDMRVQTLVTDDTGRVVGIVAKQYGKEVAVRARRGVVLAT
GSFAYNDKMIEAHAPRLIGRPGAAIEEHDGRSILMAQALGADLAHMDATEVAFVCDPQLI
VRGILVNGRGQRYVPEDTYSGRIGQMTLFHQDNQAFLIIDEASYEEGAAATTATPFLRVQ
PKWAAETVEELESDMGLPAGALQSTVEVYNKHAAEGSDPLLHKKSEWVKPIGTPVAALDL
RGFTLGFTLGGLRTTVNSEVLHVSGEPIPGLFAAGRCTSGVCAGGYASGTSLGDGSFYGR
RAGISAAKQA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacgccacaccgatccgcccccggtccgcaacaacggtcaccgagtgggactac
gaggccgacgtcgtggtcgccggttacggcatcgccggtgtggccgcctccatcgaggcc
gcgcgcgccggcgccgacgtcctggtcctcgaacgcaccagtggctggggcggtgccgcc
gctctcgccggcggcttcatctacctcggcggaggaacgccgctacagaaggcgtgcggg
ttcgacgactcccccgaaaacatgaagacgttcatgatggcggcgctcggcccgggcgcc
gacgaggagaagatcaccgactactgcgaaggcagcgtcgagcactacaactggctcgtc
gactgcggtgtcccgttcaaggagagcttctggggcgaacccggatgggaacccccgttc
gacgacggactcatgtactccggcggcgagaacgcggcgcctttcaacgagatcgcgacc
cccgcaccgcgcggccacgttccgcagatggacggcaagaggaccggcgagaagggcggc
ggctacatgctgatgaagccgctcgtcgagaccgccgaaaagctcggggtccgagccgaa
tacgacatgcgcgtccagactctcgtcacggacgacaccggtcgcgtcgtcgggatcgtc
gccaagcagtacggcaaggaggtggcggtccgggcgcgccgcggcgtcgtcctcgccacc
ggcagcttcgcctacaacgacaagatgatcgaggcccacgcgccgcgactcatcggccgc
cccggtgccgccatcgaggagcacgacggacggtcgatcctcatggcgcaggccctcggc
gccgatctcgcccacatggacgccaccgaggtcgcgttcgtctgcgacccccagttgatc
gtccgcggcatcctcgtcaacggccgggggcagcgctacgttccggaggacacctactcc
gggcggatcggccagatgaccctgttccaccaggacaaccaggcattcctcatcattgac
gaggcgtcgtacgaggaaggcgcggccgccaccacggccacgccgttcctgcgcgtccag
ccgaagtgggcggcggagactgtcgaggaactcgaatccgacatgggcctacccgccggc
gcactgcagtcgaccgtcgaggtgtacaacaagcacgccgccgaaggatcggacccgctg
ctgcacaagaagtccgagtgggtgaagccgatcggcacccccgtcgcggcactcgacctg
cgcgggttcaccctcggtttcactctcggcggcctgcggacgaccgtgaactccgaggta
ctgcacgtctccggcgaaccgatccccggcctcttcgcggcgggacggtgcacgtccggc
gtgtgcgcgggcggctacgccagcggcacctcgctcggcgacggcagcttctacggccgc
cgcgccggcatcagtgccgcgaagcaggcctga

DBGET integrated database retrieval system