KEGG   Rhodococcus jostii: RHA1_ro05861Help
Entry
RHA1_ro05861      CDS       T00382                                 

Definition
limonene 1,2-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
rha  Rhodococcus jostii
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RHA1_ro05861
Enzymes [BR:rha01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     RHA1_ro05861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6302635..6303066)
Genome map
AA seq 143 aa AA seqDB search
MSTNSHAPTGTARTDTADVQVVRAFLDALVAGDPDAAQQYLHQDIVWHNVSLPKIRGLGA
VMRILRGMSRPGVGFDVRLHHIAGDGTAVLTERTDVLIYKRLRSEFWVCGTFEMKDGKIA
VWRDYFSSRDFLWGTLKGIVRAF
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaactcgcacgcacccacgggaaccgctcgaacggacacggcagatgtccag
gtggtccgggcattcctggacgcactcgtcgcaggcgacccggacgccgcgcagcagtat
ctgcaccaggacatcgtgtggcacaacgtgtcgctgcccaagatccgcggcctcggcgcc
gtcatgcggatactccgcggaatgagccgccccggtgtcggattcgacgtgcgcctgcac
cacatcgccggcgacggtacggccgtgctgaccgaacgcacggacgtcctgatctacaag
cggctgcgcagcgaattctgggtgtgcggcacgttcgagatgaaggacggcaagatcgcc
gtctggcgcgactacttcagcagccgggacttcctgtggggcacgctcaaagggatcgtg
cgcgccttctga

DBGET integrated database retrieval system